2. Metabolic Enzyme/Protease
  3. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Angiotensin-converting Enzyme (ACE) Related Products (133):

Cat. No. Product Name Effect Purity
  • HY-19414
    MLN-4760 Inhibitor 99.93%
    MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
  • HY-12403
    Angiotensin (1-7) Inhibitor 99.91%
    Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity [1][2][3].
  • HY-12404
    Diminazene aceturate Activator
    Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties[1][2][3].
  • HY-B0368
    Captopril Inhibitor 99.85%
    Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].
  • HY-15275
    BMS-265246 Inhibitor 99.28%
    BMS-265246 is a potent and selective cyclin-dependent kinase CDK1 and CDK2 inhibitor, with IC50 values of 6 and 9 nM, respectively. BMS-265246 inhibits CHI3L1 (chitinase 3-like-1) stimulation of ACE2 (angiotensin converting enzyme 2) and SPP (viral spike protein priming proteases). BMS-265246 can be used for ovarian cancer and COVID-19 research[1][2][3].
  • HY-B0279S1
    Ramipril-d3
    Ramipril-d3 is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
  • HY-A0116S1
    Trandolaprilate-d6
    Trandolaprilate-d6 is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].
  • HY-N3470
    Isomartynoside Inhibitor
    Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC50 value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens[1][2]. IC50: 505.9 µM (ACE)[1]
  • HY-P3108
    Alamandine Inhibitor 98.95%
    Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through anti-hypertensive actions[1][2].
  • HY-114424A
    H-Ile-Pro-Pro-OH hydrochloride Inhibitor 98.48%
    H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide[1], inhibits angiotensin-converting enzyme (ACE)[1] with an IC50 of 5 μM[2]. Antihypertensive tripeptides[1].
  • HY-B0690
    Fosinopril Inhibitor
    Fosinopril (SQ28555 free acid) is the ester prodrug of angiotensin-converting enzyme (ACE) inhibitor with an IC50 value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an Ki value of 1.675 μM[1][2].
  • HY-A0230A
    Spirapril hydrochloride Inhibitor
    Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure[1].
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
  • HY-B0592S
    Trandolapril D5 Inhibitor
    Trandolapril-d5 is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].
  • HY-100450
    BML-111 Inhibitor
    BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties[1][2].
  • HY-N5063
    Plantainoside D Inhibitor 98.35%
    Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM[1]. And plantainoside D is a promising IKK-β inhibitor[2].
  • HY-118472S
    Benazeprilat-d5
    Benazeprilat-d5 is the deuterium labeled Benazeprilat[1].
  • HY-B0384
    Temocapril hydrochloride Inhibitor 99.83%
    Temocapril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].
  • HY-N2021
    Phosphoramidon Inhibitor
    Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC50 of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC50 values of 3.5, 0.034, and 78 μM, respectively[1][2][3].
  • HY-B0130A
    Perindopril erbumine Inhibitor 99.98%
    Perindopril erbumine (Perindopril tert-butylamine salt) is a potent ACE inhibitor of which is used to treat high blood pressure, heart failure or stable coronary artery disease.