1. Metabolic Enzyme/Protease
  2. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Angiotensin-converting Enzyme (ACE) Related Products (271):

Cat. No. Product Name Effect Purity
  • HY-12403
    Talfirastide Inhibitor 99.91%
    Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity [1][2][3].
  • HY-12404
    Diminazene aceturate Activator
    Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties[1][2][3].
  • HY-B0331A
    Enalapril maleate Inhibitor
    Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.
  • HY-13771
    Ursodeoxycholic acid Inhibitor
    Ursodeoxycholic acid (Ursodeoxycholate) is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection. Orally active[1][2][3][4].
  • HY-B0368
    Captopril Inhibitor 99.84%
    Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].
  • HY-Z7082
    Perindopril L-arginine Inhibitor
    Perindopril L-arginine is an orally active and selective angiotensin-converting enzyme (ACE) inhibitor. Perindopril L-arginine reduces the production of angiotensin II by inhibiting ACE, thereby dilating blood vessels, lowering blood pressure, and also exerting activities such as vasculoprotection and antithrombosis. Perindopril L-arginine is promising for research of cardiovascular diseases[1].
  • HY-106446R
    Rentiapril (Standard) Inhibitor
    Rentiapril (Standard) is the analytical standard of Rentiapril. This product is intended for research and analytical applications. Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].
  • HY-100713R
    Temocapril (Standard) Inhibitor
    Temocapril (Standard) is the analytical standard of Temocapril. This product is intended for research and analytical applications. Temocapril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].
  • HY-P3108
    Alamandine Inhibitor 98.86%
    Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through anti-hypertensive actions[1][2].
  • HY-A0117
    Temocaprilat Inhibitor
    Temocaprilat (Temocapril diacid) is an inhibitor of angiotensin-converting enzyme (ACE). Temocaprilat alleviates the inhibitory effect of high glucose on the proliferation of aortic endothelial cells. Temocaprilat has potential applications in hypertension and vascular inflammation[1][2][3][4].
  • HY-N2165R
    Vicenin 2 (Standard) Inhibitor
    Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium[1].
  • HY-114424A
    H-Ile-Pro-Pro-OH hydrochloride Inhibitor 98.48%
    H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide[1], inhibits angiotensin-converting enzyme (ACE)[1] with an IC50 of 5 μM[2]. Antihypertensive tripeptides[1].
  • HY-B0130AR
    Perindopril (erbumine) (Standard)
    Perindopril (erbumine) (Standard) is the analytical standard of Perindopril (erbumine). This product is intended for research and analytical applications. Perindopril erbumine is an angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure[1][2][3][4].
  • HY-113748
    Rev 6207 free base Inhibitor
    Rev 6207 (free base) is a potent non-thiol angiotensin I converting enzyme inhibitor. Rev 6207 (free base) has comparable antihypertensive activity to Enalapril (HY-B0331) in awake monkeys with high renin activity and can be used in the study of hypertensive diseases[1].
  • HY-B0690
    Fosinopril Inhibitor
    Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme (ACE) inhibitor with an IC50 value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an Ki value of 1.675 μM[1][2].
  • HY-122032
    A 58365A Inhibitor
    A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor[1].
  • HY-A0230A
    Spirapril hydrochloride Inhibitor
    Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure[1].
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
  • HY-A0115R
    Ramiprilat (Standard) Inhibitor
    Alvimopan (dihydrate) (Standard) is the analytical standard of Alvimopan (dihydrate). This product is intended for research and analytical applications. Alvimopan dihydrate (ADL 8-2698 dihydrate) is a potent, selective, orally active and reversible μ-opioid receptor antagonist, with an IC50 of 1.7 nM. Alvimopan dihydrate has selectivity for μ-opioid receptor (Ki=0.47 nM) over κ- and δ-opioid receptors (Kis=100, 12 nM, respectively). Alvimopan dihydrate can be used for the research of postoperative ileus[1][2][3].
  • HY-P4279
    Ovalbumin (154-159) Inhibitor 99.94%
    Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension[1][2].