Bacterial

Cat. No.	Product Name	Effect	Purity

• HY-15142

  Doxorubicin hydrochloride	Inhibitor
  Doxorubicin hydrochloride (Hydroxydaunorubicin hydrochloride; ADR), a cytotoxic anthracycline antibiotic, is an anti-cancer chemotherapy agent. Doxorubicin hydrochloride is a potent human DNA topoisomerase I and topoisomerase II inhibitor with IC50s of 0.8 μM and 2.67 μM, respectively. Doxorubicin hydrochloride reduces basal phosphorylation of AMPK and its downstream target acetyl-CoA carboxylase. Doxorubicin hydrochloride induces apoptosis and autophagy[1][2][3].

• HY-14648

  Dexamethasone	Inhibitor
  Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist, apoptosis inducer, and common disease inducer in experimental animals, constructing models of muscle atrophy, hypertension, and depression. Dexamethasone can inhibit the production of inflammatory miRNA-155 exosomes in macrophages and significantly reduce the expression of inflammatory factors in neutrophils and monocytes. Dexamethasone also has potential for use in COVID-19 research[1][2][3][4].

• HY-10219

  Rapamycin
  Rapamycin (Sirolimus; AY 22989) is a potent and specific mTOR inhibitor with an IC50 of 0.1 nM in HEK293 cells. Rapamycin binds to FKBP12 and specifically acts as an allosteric inhibitor of mTORC1[1]. Rapamycin is an autophagy activator, an immunosuppressant[2].

• HY-Y0320

  Dimethyl sulfoxide, meets analytical specification of Ch.P.	Inhibitor
  Dimethyl sulfoxide (DMSO), meets analytical specification of Ch.P. is an aprotic solvent that dissolves polar and non-polar compounds, including water-insoluble therapeutic and toxic agents. Dimethyl sulfoxide (DMSO) has a strong affinity for water and can rapidly penetrate or enhance the penetration of other substances into biological membranes. Dimethyl sulfoxide also has potential free radical scavenging and anticholinesterase effects and may affect coagulation activity. Dimethyl sulfoxide also induces histamine release from mast cells but is thought to have low systemic toxicity. Dimethyl sulfoxide also exhibits antifreeze and antibacterial properties[1][2][3]. MCE provides Dimethyl sulfoxide that complies with the inspection standards (Ch.P) of Part 4 of the Chinese Pharmacopoeia (2020 Edition). Amicrobic, low endotoxin, can be used in various biochemical experiments such as drug dissolution.

• HY-100558

  Bafilomycin A1	Inhibitor
  Bafilomycin A1 (BafA1) is a specific and reversible inhibitor of vacuolar H+-ATPase (V-ATPase) with IC50 values of 4-400 nmol/mg. Bafilomycin A1, a macrolide antibiotic, is also used as an autophagy inhibitor at the late stage. Bafilomycin A1 blocks autophagosome-lysosome fusion and inhibits acidification and protein degradation in lysosomes of cultured cells. Bafilomycin A1 induces apoptosis[1][2][3].

• HY-173054

  FtsZ-IN-12	Inhibitor
  FtsZ-IN-12 (Compound 16e) is the inhibitor for filamentous temperature-sensitive mutant Z (FtsZ) that promotes the polymerization of FtsZ protein, inhibits its GTPase activity, thereby interfering with bacterial cell division process. FtsZ-IN-12 exhibits boardspectrum antibacterial activity that inhibits B. subtilis ATCC9372, B. pumilus CMCC63202, S. aureus ATCC25923, E. coli BW25113 and A. baumannii ATCC19606 with MIC of 0.062-1 µg/mL. FtsZ-IN-12 inhibits the formation of bacterial biofilms and exhibits a clearing effect on mature biofilms. FtsZ-IN-12 exhibits bactericidal activity without hemolytic toxicity to mammalian red blood cells (15 mg/kg)[1].

• HY-173071

  DprE1-IN-13	Inhibitor
  DprE1-IN-13 (Compound 42) is the inhibitor for decaprenyl-phosphoryl-β-d-ribose oxidase (DprE1) with IC50 of 12.72 μM. DprE1-IN-13 inhibits Mycobacterium tuberculosis H37Ra with MIC50 of 1.071 μM[1].

• HY-168960

  ROS inducer 8	Inhibitor
  ROS inducer 8 (Compound 11g) is the inhibitor for glutathione (GSH), that induces the ROS accumulation in Enterococcus faecalis, thereby exhibiting antibacterial activity. ROS inducer 8 disrupts the biofilm, inhibits S. aureus and E. faecalis with MIC of 8 μg/mL and 2 μg/mL, exhibits post-antibiotic effect. ROS inducer 8 exhibits low hemolytic toxicity to sheep erythrocytes (HC50 > 1280 μg/mL)[1].

• HY-121362R

  Evernic Acid (Standard)	Inhibitor
  Propazine (Standard) is the analytical standard of Propazine. This product is intended for research and analytical applications. Propazine is a triazine herbicide that effectively manages broad-leaved weeds and annual grasses in sweet sorghum cultivation.

• HY-N6712

  Thiolutin	Inhibitor
  Thiolutin (Acetopyrrothin) is a disulfide-containing antibiotic and anti-angiogenic compound produced by Streptomyces. Thiolutin inhibits the JAMM metalloproteases Csn5, Associated-molecule-with-the-SH3-Domain-of-STAM (AMSH) and Brcc36[1]. Thiolutin is a potent and selective inhibitor of endothelial cell adhesion accompanied by rapid induction of Heat-shock protein beta-1 (Hsp27) phosphorylation[2].

• HY-W010243S

  Methylisothiazolinone-d3 hydrochloride	Inhibitor
  Methylisothiazolinone-d3 (hydrochloride) is the deuterium labeled Methylisothiazolinone (hydrochloride). Methylisothiazolinone hydrochloride is the constituent of the biocide Kathon CG. Methylisothiazolinone hydrochloride is an isothiazolone derivative widely used as a preservative. Methylisothiazolinone hydrochloride is also a moderate sensitizer and reacts with GSH.

• HY-N2492

  (E)-Methyl 4-coumarate	Inhibitor	99.87%
  (E)-Methyl 4-coumarate (Methyl 4-hydroxycinnamate), found in several plants, such as Allium cepa or Morinda citrifolia L. leaves. (E)-Methyl 4-coumarate cooperates with Carnosic Acid in inducing apoptosis and killing acute myeloid leukemia cells, but not normal peripheral blood mononuclear cells. Antioxidant and antimicrobial activity.

• HY-144341

  DprE1-IN-1	Inhibitor
  DprE1-IN-1 is a potent, orally active DprE1 inhibitor with favorable hepatocyte stability, low cytotoxicity and low hERG channel inhibition. DprE1-IN-1 displays potent activity against both agent-susceptible and clinically isolated drug-resistant Tuberculosis strains with MICs10 CFU reduction in macrophages.

• HY-147878

  Antibacterial agent 111	Inhibitor
  Antibacterial agent 111 (Compound 3) is an antibacterial agent with MIC values of 3.90 μg/mL and 0.49 μg/mL against B. cereus and K. pneumonia, respectively. Antibacterial agent 111 firmly binds with tyrosyl-tRNA synthetase residues[1].

• HY-139987A

  LeuRS-IN-1 hydrochloride	Inhibitor
  LeuRS-IN-1 hydrochloride is a potent, orally active M. tuberculosis leucyl-tRNA synthetase (M.tb LeuRS) inhibitor. LeuRS-IN-1 hydrochloride has IC50 and Kd values of 0.06 μM, 0.075 μM for M.tb LeuRS, respectively[1]. LeuRS-IN-1 hydrochloride inhibits human cytoplasmic LeuRS (IC50=38.8 μM), and HepG2 protein synthesis (EC50=19.6 μM)[2].

• HY-B1174

  Bekanamycin	Inhibitor
  Bekanamycin (Kanamycin B) is an aminoglycoside antibiotic produced by Streptomyces kanamyceticus, against an array of Gram-positive and Gram-negative bacterial strain[1][2].

• HY-B1921

  Miocamycin	Inhibitor
  Miocamycin (Midecamycin acetate) is a derivative of midecamycin (HY-B1908), a macrolide antibiotic that can be isolated from a culture broth of Streptomyces mycarofaciens. Miocamycin has antibacterial properties[1].

• HY-A0059R

  Nifuratel (Standard)	Inhibitor
  Nifuratel (Standard) is the analytical standard of Nifuratel. This product is intended for research and analytical applications. Nifuratel (NF 113, SAP 113) is a broad-spectrum antibiotic with activity against bacteria, fungi and trichomonas.

• HY-112853

  Fosmidomycin sodium salt
  Fosmidomycin sodium salt is a phosphonic acid antibiotic and a antimalarial agent, which is active against both Gram-negative and Gram-positive bacteria.

• HY-B0396

  Tebipenem pivoxil	Inhibitor
  Tebipenem pivoxil (L084) is an orally active antibiotic against a variety of pathogenic bacteria. Tebipenem pivoxil binds penicillin-binding protein (PBP), thereby inhibiting cell wall synthesis[1].

• HY-Y0319G

  Magnesium acetate tetrahydrate
  Magnesium acetate tetrahydrate is a hydrated form of anhydrous magnesium acetate salt. As a salt form of Magnesium, Magnesium acetate tetrahydrate is one of the bioavailable forms of magnesium and forms a very water soluble compound. Magnesium acetate tetrahydrate can be used as an electrolyte supplementation or a reagent in molecular biology experiments[1].

• HY-132928

  Antitubercular agent-10	Inhibitor
  Antitubercular agent-10 shows potent antitubercular activity with a MIC value of 30 nM.

• HY-156416

  LtaS-IN-2	Inhibitor
  LtaS-IN-2 (compound 13) is a inhibitor of LTA synthesis, and shows antibacterial activity against S. aureus and S. epidermidis, with the MIC90 of 0.5 μg/mL and 1 μg/mL, respectively. LtaS-IN-2 is a derivative of LtaS-IN-1 (HY-135813)[1].

• HY-N6706

  Enniatin complex	Inhibitor	99.81%
  Enniatin complex is a mixture of cyclohexadepsipeptides isolated largely from Fusarium species of fungi, and has ionophoric, antibiotic, and in vitro hypolipidaemic properties. Enniatin complex inhibits enzymes like acyl-CoA: cholesterol acyl transferase and induces apoptosis in several cancer lines [1][2].

• HY-162149

  Urease-IN-12	Inhibitor
  Urease-IN-12 (compound 5e) is a competitive urease inhibitor (IC50: 0.35 μM) with the potential to inhibit gastritis and peptic ulcer caused by Helicobacter pylori[1].

• HY-P5693

  HBA(111–142)	Inhibitor
  HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV)[1].

• HY-N8916

  Coulteropine	Inhibitor
  Coulteropine is a natural alkaloid with antimicrobial activities[1].

• HY-B1916

  Acetylspiramycin	Inhibitor
  Acetylspiramycin (Spiramycin B) is an effective oral macrolide antibiotic produced by Streptomyces, It can inhibit the splenic lymphocyte transformation induced by phytohemagglutinin (PHA), LPS (HY-D1056) and antigen, reduce the procoagulant activity of macrophages, have good antibacterial effect on gram-positive bacteria, and is also an effective antigenic insect agent, which can be used to fight parasitic infection[1][2][3][4].

• HY-103272

  iMAC2	Inhibitor
  iMAC2 is a potent MAC inhibitor with an IC50 of 28 nM and an LD50 of 15000 nM. iMAC2 shows anti-apoptotic effect. iMAC2 blocks cytochrome c release[1].

• HY-158700

  DprE1-IN-10	Inhibitor
  DprE1-IN-10 (hit 2) is a Decaprenylphosphoryl-β-D-ribose-2′-epimerase (DprE1) inhibitor. DprE1-IN-10 can be used for tuberculosis research[1].

• HY-119824

  Trofosfamide	Inhibitor
  Trofosfamide is an orally bioavailable oxazaphosphorine derivative with antineoplastic activity[1].

• HY-B0545

  Probenecid	Inhibitor	99.92%
  Probenecid is a potent and selective agonist of transient receptor potential vanilloid 2 (TRPV2) channels. Probenecid also inhibits pannexin 1 channels.

• HY-N0565B

  Doxycycline hyclate	Inhibitor
  Doxycycline hyclate, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline hyclate shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-100436

  Cadazolid	Inhibitor	98.76%
  Cadazolid (ACT-179811) is a new oxazolidinone antibiotic with potent activity against Clostridium difficile.

• HY-161432

  Antimicrobial agent-29
  Antimicrobial agent-29 (Compound C35) affects the interaction between human hemoglobin and Staphylococcus aureus IsdB hemophore. Antimicrobial agent-29 helps the discovery of IsdB:Hb PPI inhibitors[1].

• HY-N11048

  Amycolatopsin A	Inhibitor
  Amycolatopsin A is a 20-membered macrolide, that can be isolated from a strain of the rare actinomycete Amycolatopsis sp. MST‐108494. Amycolatopsin A shows antimycobacterial activity against Mycobacterium bovis (BCG) and M. tuberculosis (H37Rv) with IC50 values of 0.4 µM and 4.4 µM, respectively[1].

• HY-151957

  Antitubercular agent 34	Inhibitor
  Antitubercular agent 34 (compound 42g) is an antitubercular agent. Antitubercular agent 34 inhibits the growth of MtbH37Rv with a MIC90 value of 1.25 μg/mL with the ability of escaping metabolic degradation by human liver microsomes. Antitubercular agent 34 can be used for the research of tuberculosis[1].

• HY-131718

  (1-Isothiocyanatoethyl)benzene	Inhibitor
  (1-Isothiocyanatoethyl)benzene (compound 27) is an antimicrobial agent[1].

• HY-111643

  6-Amino-5-azacytidine	Inhibitor
  6-Amino-5-azacytidine inhibits the growth of bacteria E. coli[1].

• HY-N7139S1

  Penicillin G-d7 potassium salt
  Penicillin G-d7 (potassium) is the deuterium labeled Penicillin G potassium salt[1].

• HY-129285

  A83016A	Inhibitor
  A 83016A is a kinamycin-type antibiotic with the MIC of 4 ug/ml aganist En terococcus faecium[1].

• HY-N6952

  Geraniol	Inhibitor
  Geraniol is an olefin terpene with oral activity. Geraniol inhibits cell proliferation and promotes apoptosis. Geraniol has antibacterial, antifungal, antioxidant, anti-inflammatory and antitumor activities. Geraniol can be used to study diabetes[1][2][3][4][5].

• HY-167669

  Tioxacin	Inhibitor
  Tioxacin is an orally active bactericide agent. Tioxacin combined with aliphatic amines has activities against G(+) and G (-) bacteria, including Escherichia coli resistant to Nalidixic acid (HY-B0398) and Pseudomonas aeruginosa[1].

• HY-16980

  Eravacycline	Inhibitor
  Eravacycline is a potent and broad-spectrum antibacterial agent.

• HY-N0680R

  Thiamine (hydrochloride) (Standard)
  Thiamine (hydrochloride) (Standard) is the analytical standard of Thiamine (hydrochloride). This product is intended for research and analytical applications. Thiamine hydrochloride (Thiamine chloride hydrochloride) is an essential micronutrient needed as a cofactor for many central metabolic enzymes.

• HY-130836

  LpxH-IN-AZ1	Inhibitor	99.10%
  LpxH-IN-AZ1, a sulfonyl piperazine compound, is a potent UDP-2,3-diacylglucosamine pyrophosphate hydrolase LpxH inhibitor. LpxH-IN-AZ1 is a potent inhibitor of Klebsiella pneumoniae LpxH with IC50 of 0.36 μM [1].

• HY-118362

  Netzahualcoyonol	Inhibitor
  Netzahualcoyonol is a quinone methyl triterpene isolated from the roots of Salacia multiflora (Lam.) DC. Netzahualcoyonol exhibits antibacterial and anti-biofilm activities. Netzahualcoyonol inhibits Gram-positive bacteria (MIC=3.26–52 μM). Additionally, Netzahualcoyonol demonstrates cytotoxicity against Hep G2 cells (IC50 = 1.95 μM) but exhibits low toxicity towards Vero cells[1][2].

• HY-118651

  Griseoluteic acid
  Griseoluteic acid, a phenazine antibiotic, is originally isolated from S. griseoluteus. Griseoluteic acid is a breakdown product of griseolutein A and B[1].

• HY-10845

  CGI-17341	Inhibitor
  CGI-17341 is a 5-nitroimidazole antibacterial agent that has the activity of inhibiting sensitive and multidrug-resistant strains of Mycobacterium tuberculosis in vitro and prolonging the survival time of mice infected with Mycobacterium tuberculosis in vivo in a dose-dependent manner.

• HY-146591

  Antibacterial agent 87	Inhibitor
  Antibacterial agent 87 (Compound 4h) is a potent antibacterial agent with MIC values of 0.125, 0.0625 and 0.0625 μg/mL against MRSA, MRSE and S. aureus, respectively[1].

• HY-129331

  Neothramycin A	Inhibitor
  Neothramycin A is an antibiotic, which can be isolated from Streptomyces. Neothramycin A exhibits board spectrum antimicrobial activity, inhibits Staphylococcus aureus, Klebsiella pneumoniae, Escherichia coli W677, and Saccharomyces cerevisia with MIC of 25-50 μg/mL. Neothramycin A exhibits antitumor efficacy against leukemia in mouse models[1].

• HY-W654013

  Minocycline-d7	Inhibitor
  Minocycline-d7 is deuterium labeled Minocycline. Minocycline is an orally active, potent and BBB-penetrated semi-synthetic tetracycline antibiotic. Minocycline is a hypoxia-inducible factor (HIF)-1α inhibitor. Minocycline shows anti-cancer, anti-inflammatory, and glutamate antagonist effects. Minocycline reduces glutamate neurotransmission and shows neuroprotective properties and antidepressant effects. Minocycline inhibits bacterial protein synthesis through binding with the 30S subunit of the bacterial ribosome, resulting in a bacteriostatic effect[1][2][3][4][5][6][7][8].

• HY-165272

  Antibiotic SF-2132
  Antibiotic SF-2132 is a peptide antibiotic identified in Nocardiopsis sp., which exhibits inhibitory activity against β-lactam antibiotic-resistant strains, such as Pseudomonas and Escherichia[1].

• HY-146699

  MtTMPK-IN-5	Inhibitor
  MtTMPK-IN-5 (compound 17) is a potent M. tuberculosis thymidylate kinase (MtbTMPK) inhibitor with an IC50 value of 34 μM. MtTMPK-IN-5 combines favorable enzyme inhibitory activity with significant activity against M. tuberculosis (MIC = 12.5 μM). MtTMPK-IN-5 can be used for researching tuberculosis[1].

• HY-P2011

  Cephabacin M4	Inhibitor
  Cephabacin M4 is a cephalosporin component, a 7-methoxydesacetylcephalosporin. Cephabacin M4 can be isolated from the culture filtrate of Xanthomonas lactamica.

• HY-19647

  Ritipenem acoxil	Inhibitor
  Ritipenem acoxil (FCE 22891; RIPM-AC) is an oral active beta-lactamase antibiotic and can be used for study of bacterial pneumonia[1].

• HY-W009350

  Diazolidinyl urea	Inhibitor
  Diazolidinyl urea, a broad spectrum preservative, is a formaldehyde-releasing compound that releases formaldehyde through its decomposition. Diazolidinyl urea is effective against most contaminating microorganisms, especially Pseudomonas[1][2].

• HY-115900

  Tuberculosis inhibitor 4	Inhibitor
  Tuberculosis inhibitor 4 (compound 16), a mandelic acid-based spirothiazolidinone, has potent antimycobacterial activity against Mycobacterium tuberculosis strain H37Rv with the high inhibition value 98% at lower than 6.25 µg/mL concentration[1].

• HY-B1892S1

  Cefazolin-13C2,15N	Inhibitor
  Cefazolin-13C2,15N (Cephazolin-13C2,15N) is 13C and 15N labeled Cefazolin. Cefazolin (Cephazolin) is a first-generation cephalosporin antibiotic and can be used in varieties of bacterial infections research[1]. Cefazolin has anti-inflammatory effect and can attenuate post-operative cognitive dysfunction (POCD)[2].

• HY-135842

  Aspoxicillin	Inhibitor	99.56%
  Aspoxicillin is a broad-spectrum antimicrobial agent against 68 isolates of Actinobacillus pleuropneumoniae with an MIC90 value of <= 0.05 μg/ml. Aspoxicillin has a long half-life in mouse serum of 55 minutes[1][2].

• HY-121136A

  Chartreusin sodium
  Chartreusin sodium is an antibiotic that is active against certain Gram-positive organisms and mycobacteria. Chartreusin is also active against the Micrococcus fiyogenes v. aureus phage[1].

• HY-P1630

  Buforin II	Inhibitor	98.61%
  Buforin II, derived from buforin I, a protein isolated from the stomach of the Asian toad Bufo bufo gargarizans, is a potent antimicrobial peptide. Buforin II has antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria[1].

• HY-137371

  Lactonic sophorolipid	Inhibitor
  Lactonic sophorolipid is a natural antimicrobial surfactant for oral hygiene[1]. Lactonic sophorolipid, a potential anticancer agent, induces apoptosis in human HepG2 cells through the caspase-3 pathway[1].

• HY-D1485

  3,3'-Diethylthiacyanine iodide
  3,3'-Diethylthiacyanine iodide is a cyanine fluorescent dye. 3,3'-Diethylthiacyanine iodide manifestes a pronounced affinity for bacterial cells[1].

• HY-P5721

  Apidaecin IA	Inhibitor
  Apidaecin IA is an antibacterial peptide that can be found in honeybees[1].

• HY-B1454

  Clindamycin palmitate hydrochloride	Inhibitor
  Clindamycin palmitate hydrochloride is a hydrochloride salt of the ester of clindamycin and palmitic acid and it is an antibacterial agent. Clindamycin palmitate hydrochloride is inactive in vitro, rapid in vivo hydrolysis converts this compound to the antibacterially active clindamycin[1].

• HY-144278

  Anti-MRSA agent 1	Inhibitor
  Anti-MRSA agent 1 (Compound 13d) is a wonderful MRSA (MIC = 0.5 μg/mL) inhibitor. Anti-MRSA agent 1 (Compound 13d) could effectually relieve the development of MRSA resistance[1].

• HY-157883

  C7BzO	Inhibitor
  C7BzO (Dimethyl-2-hydroxyethylampropanepropanesulfonate) is a potent solubilizing detergent that can be used for samples such as bacteria, mammals, and plants. C7BzO can be used for the extraction of proteins and the preparation of two-dimensional gel electrophoresis samples[1].

• HY-W399439

  Aurantiogliocladin	Inhibitor
  Aurantiogliocladin is a weak antibiotic which was active against Staphylococcus epidermidis but not S. aureus. Aurantiogliocladin could inhibit biofilm formation[1].

• HY-N7120

  Penicillin G procaine hydrate	Inhibitor	99.52%
  Penicillin G Procaine hydrate (PGP hydrate), a β-lactam antibiotic, is a crystalline complex produced by chemically combining penicillin G with procaine[1][2].

• HY-N6810S

  Thymol-d13		98.73%
  Thymol-d13 is the deuterium labeled Thymol[1]. Thymol is the main monoterpene phenol occurring in essential oils isolated from plants belonging to the Lamiaceae family, and other plants such as those belonging to the Verbenaceae, Scrophulariaceae, Ranunculaceae and Apiaceae families. Thymol has antioxidant, anti-inflammatory, antibacterial and antifungal effects[2].

• HY-B1674S

  (±)-Leucine-d10	Inhibitor
  (±)-Leucine-d10 is the deuterium labeled (±)-Leucine. (±)-Leucine (DL-Leucine), an isomer of Leucine, chemosterilant and dietary additive. (±)-Leucine inhibits growth of Escherichia coli HfrH by 92.08%[1].

• HY-116251

  CID21480113	Inhibitor
  CID21480113 is an inhibitor of dapsone-resistant leprosy[1].

• HY-118992

  Aurodox	Inhibitor
  Aurodox (X 5108) is an antibiotic obtained from a streptomyces variant, Aurodox can against a number of gram-positive bacteria. Aurodox shows a very low toxicity in mice and promoted poultry growth[1].

• HY-B0330S2

  Levofloxacin-13C,d3	Inhibitor
  Levofloxacin-13C,d3 is the 13C- and deuterium labeled Levofloxacin.

• HY-N0368

  Linalool	Inhibitor
  Linalool is a natural monoterpene which is a competitive NMDA receptor antagonist. Linalool is orally active and crosses the blood-brain barrier. Linalool has anticancer, antibacterial, anti-inflammatory, neuroprotective, anxiolytic, antidepressant, anti-stress, cardioprotective, hepatoprotective, nephroprotective and pulmonary protective activities[1][2][3][4][5].

• HY-Y0479S

  L-Lactic acid-13C3
  L-Lactic acid-13C3 is a 13C-labeled L-Lactic acid (HY-Y0479). L-Lactic acid-13C3 can be used for lactate metabolism research[1].

• HY-17592

  Bithionol	Inhibitor	99.27%
  Bithionol is an antibacterial, anthelmintic, and algaecide agent. Bithionol is also a potent inhibitor of soluble adenylyl cyclase through binding to the allosteric activator site (IC50: 4 μM)[1][2].

• HY-122123

  S-6123	Inhibitor
  S-6123 is a potent antimicrobial compound of the oxazolidinone series. S-6123 inhibits ribosomal protein synthesis without inhibiting DNA or RNA synthesis[1].

• HY-W778140

  Diethyl phosphate-13C4 sodium	Inhibitor
  Diethyl phosphate-13C4 (sodium) is the 13C labeled isotope of Diethyl phosphate-13C4 (sodium)(HY-101417).Diethylphosphate (DEP) is product of metabolism and of environmental degradation of a commonly used insecticide Chlorpyrifos[1].

• HY-13725R

  Pirarubicin (Standard)	Inhibitor
  Pirarubicin (Standard) is the analytical standard of Pirarubicin. This product is intended for research and analytical applications. Pirarubicin is an anthracycline antibiotics, acts as a topoisomerase II inhibitor, and is a widely used for treatment of various cancers, in particular, solid tumors.

• HY-163762

  Antibacterial agent 226	Inhibitor
  Antibacterial agent 226 (Compound 7f) is an antibacterial agent, that inhibits Staphylococcus aureus strains and methicillin-resistant S. aureus strain with MIC of 2 μg/mL. Antibacterial agent 226 exhibits cytotoxicity to HEK293 with IC50 of 1.9 μM[1].

• HY-17021C

  Esomeprazole hemistrontium
  Esomeprazole ((S)-Omeprazole) hemistrontium is a potent and orally active proton pump inhibitor and reduces acid secretion through inhibition of the H+, K+-ATPase in gastric parietal cells. Esomeprazole hemistrontium has the potential for symptomatic gastroesophageal reflux disease research[1][2][3].

• HY-169338

  Antibacterial agent 253	Inhibitor
  Antibacterial agent 253 (compound 7a) is a potent inhibitor of bacterial, with the MIC of 1.562 μg/mL for P. aeruginosa, S. aureus, L. monocytogenes, B. cereus, and S. typhi[1].

• HY-148569

  TMV-IN-3
  TMV-IN-3, chalcone derivative, is a tobacco mosaic virus (TMV) inhibitor. TMV-IN-3 has antiviral activity against TMV with an EC50 value of 120.3 μg/mL. TMV-IN-3 can be used for the research of infection, inflammation and tumor[1].

• HY-118169

  A-Factor
  A-Factor is an inducer of streptomycin biosynthesis in an inactive mutant of Streptomyces griseus. In addition, A-Factor can also induce spore formation during conidial development of Magnaporthe oryzae[1].

• HY-B1282A

  Sulfaquinoxaline sodium salt	Inhibitor	99.72%
  Sulfaquinoxaline sodium salt is an antimicrobial for veterinary use, with activity against a broad spectrum of Gram-negative and Gram-positive bacteria. Sulfaquinoxaline is used to prevent coccidiosis and bacterial infections[1][2].

• HY-W337680

  N-3-Hydroxydecanoyl-L-homoserine lactone
  N-3-Hydroxydecanoyl-L-homoserine lactone is a type of N-acyl-L-homoserine lactone (AHL), which is a class of signaling molecules in bacterial quorum sensing systems, and it has a weak activating effect on AbaR[1].

• HY-17362R

  Vancomycin (hydrochloride) (Standard)	Inhibitor
  Vancomycin (hydrochloride) (Standard) is the analytical standard of Vancomycin (hydrochloride). This product is intended for research and analytical applications. Vancomycin hydrochloride is an antibiotic for the treatment of bacterial infections. It acts by inhibiting the second stage of cell wall synthesis of susceptible bacteria. Vancomycin also alters the permeability of the cell membrane and selectively inhibits ribonucleic acid synthesis.

• HY-101411S

  4-Acetamidobutanoic acid-d3	Inhibitor
  4-Acetamidobutanoic acid-d3 is the deuterated analog of 4-Acetamidobutanoic acid (HY-101411). 4-Acetamidobutanoic acid (N-acetyl GABA), the main metabolite of GABA, exhibits antioxidant and antibacterial activities[1].

• HY-N10930

  7-Oxo-ganoderic acid Z	Inhibitor
  7-Oxo-ganoderic acid Z, a terpenoid, is a nature product that could be isolated from Resina Commiphora. 7-Oxo-ganoderic acid Z has Anti-Mycobacterium tuberculosis activity[1].

• HY-12820

  Sibofimloc	Inhibitor	99.70%
  Sibofimloc (Antibiotic-202) is a first-in-class, gut-restricted, orally active FimH adhesion inhibitor extracted from patent WO2014100158A1, Compound Example 202. Sibofimloc has anti-bacterial infective activity. Sibofimloc is developed for inflammatory bowel disease (IBD)[1][2].

• HY-139424

  SQ609
  SQ609 is a lead compound from a library of dipiperidines. SQ609 inhibits more than 90% of intracellular bacterial growth at 4μg/ml and is toxic to these cells. SQ609 displays a potent antitubercular activity [1].

• HY-P10200

  CP7-FP13-2	Inhibitor
  CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice[1].

• HY-131011

  Furanone C-30	Inhibitor
  Furanone C-30 is a quorum sensing inhibitor. Furanone C-30 can effectively inhibit bacterial biofilm formation by S. mutans and its luxSmutant strain[1].

• HY-W072009

  5,7-Dihydroxycoumarin	Inhibitor
  5,7-Dihydroxycoumarin is a coumarin isolated from the inflorescences of Macaranga triloba. 5,7-dihydroxycoumarin displays antibacterial characteristics with an MIC value in the range of 1000 mg/mL to >1000 mg/mL. Some 5,7-dihydroxycoumarin derivatives have antioxidant properties[1][2][3].

• HY-N12905

  Celastramycin A (isomer)	Inhibitor
  Celastramycin A isomer is an isomer of Celastramycin A (HY-122292), an antibiotic against Gram-negative bacteria and Mycobacterium tuberculosis with an MIC of 0.05-3.1 μg/mL. Celastramycin A exerts immunosuppressive effects in Drosophila ex vivo via the immunodeficiency pathway (IC50 of 8 ng/mL), inhibits human innate immune responses via the TNF-α pathway, and inhibits IL-8 production in HUEVC with an IC50 of 60 ng/mL[1][2].

• HY-N6680

  Virginiamycin S1	Inhibitor
  Virginiamycin S1 is a cyclic hexadepsipeptide antibiotic, inhibits bacterial protein synthesis at the level of aminoacyl-tRNA binding and peptide bond formation. Virginiamycin S1 belongs to the type B compounds in the streptogramin family and is produced by Streptomyces virginiae, shows a strong bactericidal activity against a wide range of Gram-positive bacteria. Virginiamycin S1 together with virginiamycin M1 is more effective in treat multidrug-resistant bacterial infections[1][2].

• HY-151958

  Antitubercular agent-35	Inhibitor
  Antitubercular agent-35 (compound 42l) is an antitubercular agent. Antitubercular agent-35 inhibits the growth of MtbH37Rv and M. Marinum with MIC90 values of 1.25 and 2 μg/mL, respectively. Antitubercular agent-35 shows the ability of escaping metabolic degradation by human liver microsomes. Antitubercular agent-35 can be used for the research of tuberculosis[1].

• HY-14879C

  Avibactam sodium dihydrate	Inhibitor
  Avibactam sodium (NXL-104) dihydrate is a covalent and reversible non-β-lactam β-lactamase inhibitor which inhibits β-lactamase TEM-1 and CTX-M-15 with IC50s of 8 nM and 5 nM, respectively[1].

• HY-B0963

  Cloxiquine	Inhibitor
  Cloxiquine (5-Chloro-8-quinolinol) is an antibacterial, antifungal and antiamoebic agent. Cloxiquine can be used for the research of tuberculosis and dermatoses. Cloxiquine suppresses the growth and metastasis of melanoma cells through activation of PPARγ[1][2].

• HY-B0199

  Mycophenolate Mofetil		99.83%
  Mycophenolate mofetil (RS 61443) is the morpholinoethylester proagent of Mycophenolic acid. Mycophenolate mofetil inhibits de novo purine synthesis via the inhibition of inosine monophosphate dehydrogenase (IMPDH). Mycophenolate mofetil shows selective lymphocyte antiproliferative effects involve both T and B cells, preventing antibody formation[1].

• HY-B0508

  Ornidazole	Inhibitor	99.58%
  Ornidazole(Ro 7-0207) is a 5-nitroimidazole derivative with antiprotozoal and antibacterial properties against anaerobic bacteria.

• HY-B0275BR

  Oxytetracycline (dihydrate) (Standard)	Inhibitor
  Oxytetracycline (dihydrate) (Standard) is the analytical standard of Oxytetracycline (dihydrate). This product is intended for research and analytical applications. Oxytetracycline dihydrate is an antibiotic belonging to the tetracycline class. Oxytetracycline dihydrate potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline dihydrate is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline dihydrate also possesses anti-HSV-1 activity[1][2][3].

• HY-B1159S

  Nitroxoline-D4	Inhibitor
  Nitroxoline-d4 is the deuterium labeled Nitroxoline. Nitroxoline is an antibiotic that has proven to be very effective at combating biofilm infections. Nitroxoline functions by chelating Fe2+ and Zn2+ ions from the biofilm matrix[1][2].

• HY-P5728

  Aurein 1.1	Inhibitor
  Aurein 1.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria raniformis[1].

• HY-B1128AR

  Cefamandole (sodium) (Standard)	Inhibitor
  Cefamandole (sodium) (Standard) is the analytical standard of Cefamandole (sodium). This product is intended for research and analytical applications. 0

• HY-N2040

  (20R)-Protopanaxadiol	Inhibitor
  (20R)-Protopanaxadiol is a triterpenoid saponin metabolite of 20(R)-ginsenoside Rg3 in black ginseng. (20R)-Protopanaxadiol exhibits anti-tumor activity and cytotoxicity, and potently inhibits the growth of Helicobacter pylori[1][2][3].

• HY-N7057S3

  Nonanoic acid-d2		98.63%
  Nonanoic acid-d2 is the deuterium labeled Nonanoic acid[1]. Nonanoic acid is a naturally-occurring saturated fatty acid with nine carbon atoms. Nonanoic acid significantly reduces bacterial translocation, enhances antibacterial activity, and remarkably increases the secretion of porcine β-defensins 1 (pBD-1) and pBD-2[2].

• HY-148690

  L18-MDP	Inhibitor
  L18-MDP is a derivative of muramyl dipeptide, an antibacterial agent. L18-MDP has antibacterial activity and has potential applications in bacterial and fungal infections[1].

• HY-B0688

  Dapsone	Inhibitor	99.76%
  Dapsone (4,4′-Diaminodiphenyl sulfone) is an orally active and blood-brain penetrant sulfonamide antibiotic with bacteriostatic, antimycobacterial and antiprotozoal activities[1]. Dapsone?exerts effective antileprosy activity?and inhibits folate synthesis in cell extracts of?M. leprae. Dapsone is used for dermatologic disorder research, including leprosy, dermatitis herpetiformis, acne vulgaris et al[2][3].

• HY-W013699

  Chlorhexidine diacetate	Inhibitor
  Chlorhexidine diacetate is a biguanide disinfectant with rapid bactericidal activity against both Gram-positive and Gram-negative organism. The antibacterial effect of chlorhexidine diacetate is related to its action on the bacterial cell membrane and to precipitation of intracellular contents[1].

• HY-17357

  Nepafenac		99.51%
  Nepafenac (AHR 9434; AL 6515; Nevanac) is a COX-2 inhibitor and the original drug of Amfenac.

• HY-122777

  γ-Rubromycin	Inhibitor
  γ-Rubromycin is a natural product from Streptomyces. γ-Rubromycin has antibacterial activity[1].

• HY-N7118

  Clindamycin hydrochloride monohydrate	Inhibitor
  Clindamycin hydrochloride monohydrate is an oral protein synthesis inhibitory agent that has the ability to suppress the expression of virulence factors in Staphylococcus aureus at sub-inhibitory concentrations (sub-MICs). Clindamycin hydrochloride monohydrate resistance results from enzymatic methylation of the antibiotic binding site in the 50S ribosomal subunit (23S rRNA). Clindamycin hydrochloride monohydrate decreases the production of Panton-Valentine leucocidin (PVL), toxic-shock-staphylococcal toxin (TSST-1) or alpha-haemolysin (Hla)[1].

• HY-W243002

  Acetyl-L-homoserine lactone	Control
  Acetyl-L-homoserine lactone is a member of the family of N-acylated homoserine lactones (HSLs). Acetyl-L-homoserine lactone is a polar mediator of cell-cell interactions in bacterial biofilms[1].

• HY-W654101

  Cefotaxime-d3	Inhibitor	98.00%
  Cefotaxime-d3 is the deuterium labeled Cefotaxime (HY-A0088A). Cefotaxime is the β-lactamase stable cephalosporin and the third-generation cephalosporin antibiotic. Cefotaxime possesses broad-spectrum antibiotic activity against numerous Gram-positive and Gram-negative bacteria[1][2][3][4][5].

• HY-N2417

  Stearyl glycyrrhetinate	Inhibitor
  Stearyl glycyrrhetinate, a major component in licorice extract, has a MIC against S. aureus strains of more than 256 mg/L. Stearyl glycyrrhetinate has antibacterial effects[1].

• HY-167841

  Anti-MRSA agent 19	Inhibitor
  Anti-MRSA agent 19 (Compound 1) is an antibiotic that exhibits activity against S. aureus. Anti-MRSA agent 19 is a active (median MIC=4 μg/mL) against 40 CDC isolates of different bacterial species containing various resistance factors, including Vancomycin (HY-B0671), aminoglycoside/Tetracycline (HY-A0107), and oxazolidinone resistance[1].

• HY-116010

  Oleandomycin	Inhibitor
  Oleandomycin is a macrolide antibiotic structurally closely related to Erythromycin. Oleandomycin is similar to Erythromycin with antimicrobial activity. Oleandomycin inhibits protein synthesis by interference with translation of activated amino acids to nascent peptide chains on the ribosomes[1][2].

• HY-158761

  Polyaminopropyl biguanide	Inhibitor
  Polyaminopropyl biguanide (PAPB), a propyl analogue of polyhexamethylene biguanide, is a broad spectrum, fast acting bactericide with antibacterial activity. Polyaminopropyl biguanide can be used as a preservative in cosmetic products[1].

• HY-125424

  AM8191 hydrochloride	Inhibitor
  AM8191 is an orally active bactericidal and selectively inhibits DNA synthesis and Staphylococcus aureus gyrase (IC50=1.02 μM) and topo IV (IC50=10.4 μM). AM8191 inhibits S. aureus MSSA (MIC=0.02 μg/mL) and S. aureus MRSA (MIC=0.06 μg/mL)[1].

• HY-B0810AR

  Pivmecillinam (hydrochloride) (Standard)	Inhibitor
  Pivmecillinam (hydrochloride) (Standard) is the analytical standard of Pivmecillinam (hydrochloride). This product is intended for research and analytical applications. Pivmecillinam hydrochloride (FL-1039 hydrochloride) is an orally active proagent of mecillinam, an extended-spectrum penicillin antibiotic.

• HY-131044

  5-[(2-Nitrophenyl)methylene]-2,4-thiazolidinedione	Inhibitor
  5-[(2-Nitrophenyl)methylene]-2,4-thiazolidinedione (Compound 4) has antimicrobial, anti-diabetic and antioxidant activities. 5-[(2-Nitrophenyl)methylene]-2,4-thiazolidinedione inhibits B. subtilis, S. aureus, K. pneumonia, E. coli, and S. typhi with MICs of 4.5-9.9 μΜ/mL, and inhibits A. niger and C. albicans with MICs of 4.99 μΜ/mL[1].

• HY-117741

  GSK951A	Inhibitor
  GSK951A is a THPP analogue. GSK951A inhibits mycolic acid biosynthesis. GSK951A combines potency in culture with in vivo activity and lack of cytotoxicity[1].

• HY-109587B

  BM635 mesylate	Inhibitor
  BM635 mesylate is a MmpL3 inhibitor with outstanding anti-mycobacterial activity. BM635 mesylate has a MIC50 of 0.6 μM against M. tuberculosis  H37Rv. BM635 mesylate significantly improves the bioavailability compared to free-base BM635[1].

• HY-N0286R

  Isoimperatorin (Standard)	Inhibitor
  Isoimperatorin (Standard) is the analytical standard of Isoimperatorin. This product is intended for research and analytical applications. Isoimperatorin is a methanolic extract of the roots of Angelica dahurica shows significant inhibitory effects on acetylcholinesterase (AChE) with the IC50 of 74.6 μM.

• HY-114748

  AHU1
  AHU1 is a compound that inhibits the expression of Shiga toxin type 2 in Escherichia coli O157:H7, demonstrating a dose-dependent reduction in toxin activity by interfering with the SOS response through its effects on RecA.

• HY-N2026R

  Propylparaben (Standard)	Inhibitor
  Propylparaben (Standard) is the analytical standard of Propylparaben. This product is intended for research and analytical applications. Propylparaben (Propyl parahydroxybenzoate) is an antibacterial preservative that can be produced by plants and bacteria. Propylparaben is commonly used in cosmetics, pharmaceuticals and foods. Propylparaben disrupts follicular growth and steroidogenic function by altering cell cycle, apoptosis and steroidogenic pathways. Propylparaben also reduced sperm count and motility in rats[1][2][3][4][5][6].

• HY-B1831A

  Oritavancin diphosphate	Inhibitor	99.93%
  Oritavancin diphosphate (LY333328 diphosphate), a semisynthetic derivative of Vancomycin (HY-B0671), is an orally active glycopeptide antibiotic with bactericidal activity against gram-positive organisms. Oritavancin diphosphate shows antibacterial effect against B. anthracis, such as Ames strain with a MIC value of 0.015 g/mL. Oritavancin diphosphate inhibits cell wall synthesis and disrupts the membrane potential. Oritavancin diphosphate inhibits ArlS kinase activity thereby interfering the signal transduction. Oritavancin diphosphate enters cells by adsorptive endocytosis, which drives it to lysosomes, where it exerts antibiotic activity[1][2][3][4][5].

• HY-B0712A

  Ceftriaxone sodium hydrate	Inhibitor	99.25%
  Ceftriaxone sodium hydrate (Ro 13-9904 sodium hydrate) is a broad spectrum β-lactam third-generation cephalosporin antibiotic, which has good antibacterial activity against a variety of gram-negative and positive bacteria. Ceftriaxone sodium hydrate is a covalent inhibitor of GSK3β with IC50 value of 0.78 μM. Ceftriaxone sodium hydrate is an inhibitor of Aurora B. Ceftriaxone sodium hydrate has anti-inflammatory, antitumor and antioxidant activities. Ceftriaxone sodium hydrate can be used in the study of bacterial infections and meningitis[1][2][3][4][5][6][7].

• HY-121144

  Cefazedone	Inhibitor	99.89%
  Cefazedone (Refosporen), a first-generation cephalosporin, is a time-dependent antibiotic with activity against Gram-positive and Gram-negative bacteria[1].

• HY-N3075

  Phytol	Inhibitor
  Phytol ((E)-Phytol) is an orally active diterpenoid alcohol that can be extracted from chlorophyll. Phytol has antioxidant, anti-inflammatory, anti-schistosomiasis and antibacterial activities[1][2][3].

• HY-163957

  Tambjamine LY2	Inhibitor
  Tambjamine LY2 is an algicidal compound with significant algaecidal effects. Bacterial membrane vesicles (BMVs) may be involved in bacteria-algae communication, so BMV encapsulation can be effectively delivered to the microalgae Heterosigma akashiwo and Thalassiosira pseudonana through membrane fusion[1].

• HY-N8373

  Beauvericin A
  Beauvericin A is a cyclodepsipeptide and derivative of beauvericin originally isolated from B. bassiana that has diverse biological activities. It is active against M. tuberculosis (MIC=25 μg/mL) and P. falciparum (IC50=12 μg/mL).2 Beauvericin A is toxic to brine shrimp (LD100=32 μg/mL).

• HY-151354

  Antibacterial agent 121	Inhibitor
  Antibacterial agent 121 (Compound 10) is an antibacterial agent. Antibacterial agent 121 shows anti-mycobacterial and anti-inflammatory activities and can be used in Tuberculosis (TB) research[1].

• HY-P4474

  Pz-Pro-Leu-Gly-Pro-d-Arg
  Pz-Pro-Leu-Gly-Pro-d-Arg is a synthetic substrate of bacterial collagenase. Pz-Pro-Leu-Gly-Pro-d-Arg can be used to test bacterial collagenase activity[1].

• HY-B0134R

  Bestatin (Standard)	Inhibitor
  Bestatin (Standard) is the analytical standard of Bestatin. This product is intended for research and analytical applications. Bestatin is a natural, broad-spectrum, and competitive CD13 (Aminopeptidase N)/APN and leukotriene A4 hydrolase inhibitor. Bestatin has anticancer effects[1][2].

• HY-128488

  Antibiotic TAN-592B	Inhibitor
  Antibiotic TAN-592B is an antibiotic against infectious disease caused by bacteria[1].

• HY-I0501

  2'-Aminoacetophenone		99.82%
  2'-Aminoacetophenone is an orally active inducer of apoptosis and respiratory biomarker. 2'-Aminoacetophenone can be used to detect Pseudomonas aeruginosa infections in the lungs of cystic fibrosis patients. 2'-Aminoacetophenone can inhibit the protein levels of LC3BII and p62 in macrophages infected with pqsA or mvfR and regulate autophagy. 2'-Aminoacetophenone can disrupt mitochondrial function by inducing oxidative stress and apoptosis signaling, leading to dysfunction in mouse skeletal muscle[1][2][4].

• HY-N0216S1

  Benzoic acid-13C6	Inhibitor
  Benzoic acid-13C6 is the 13C-labeled Benzoic acid. Benzoic acid is an aromatic alcohol existing naturally in many plants and is a common additive to food, drinks, cosmetics and other products. It acts as preservatives through inhibiting both bacteria and fungi.

• HY-B1148AR

  Furaltadone (Standard)	Inhibitor
  Furaltadone (Standard) is the analytical standard of Furaltadone. This product is intended for research and analytical applications. Furaltadone, a nitrofuran agent, has the potential for the study in infections of chickens with salmonella enteritidis. Furaltadone is inhibitory and bactericidal in vitro for staphylococci [1][2].

• HY-107373

  β-Chloro-L-alanine	Inhibitor
  β-Chloro-L-alanine is a bacteriostatic amino acid analog which inhibits a number of enzymes, including threonine deaminase and alanine racemase.

• HY-P3512

  Iseganan	Inhibitor
  Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research[1][2][3].

• HY-19581S

  Baquiloprim-d6	Inhibitor
  Baquiloprim-d6 is deuterium labeled Baquiloprim. Baquiloprim, an antibiotic, is a selective inhibitor of bacterial dihydrofolate reductases. Baquiloprim possesses in vitro bacteriostatic activity against both Gram-negative and Gram-positive bacteria[1][2].

• HY-P5391

  LL-37(17-32)	Inhibitor
  LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)

• HY-N14168

  Ashimycin A	Inhibitor
  Ashimycin A is a Streptomycin (HY-B1906) analogue with a broad-spectrum antibacterial activity[1].

• HY-151168

  3-Chlorogentisyl alcohol	Inhibitor	99.80%
  3-Chlorogentisyl alcohol is a potent E. coli β-glucuronidase inhibitor with an IC50 value of 0.74 μM, an Ki value of 0.58 μM. 3-Chlorogentisyl alcohol shows antiproliferative activity. 3-Chlorogentisyl alcohol has the potential for the research of anti-cancer and anti-inflammatory therapies[1].

• HY-B1781S

  Sulfachloropyridazine-13C6	Inhibitor
  Sulfachloropyridazine-13C6 is the 13C6 labeled Sulfachloropyridazine. Sulfachloropyridazine is a broad spectrum sulfonamide used against both Gram-positive and Gram-negative aerobic bacteria.

• HY-B0330S1

  (S)-Ofloxacin-d3	Inhibitor
  (S)-Ofloxacin-d3 is the deuterium labeled Levofloxacin. Levofloxacin, a synthetic fluoroquinolone, is an antibacterial agent that inhibits the supercoiling activity of bacterial DNA gyrase, halting DNA replication.

• HY-P4204

  Ranalexin	Inhibitor
  Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL[1].

• HY-W320276

  Dill apiole	Inhibitor
  Dill apiole is an aromatic ether, which is an important aroma component in herbs and spices such as dill (Anethum graveolens), parsley (Petroselinum crispum) and basil (Perilla frutescens). Dill apiole exhibits antimicrobial activity against Aspergillus parasiticus and Aedes aegypti[1].

• HY-136330

  Oxazosulfyl	Inhibitor	99.88%
  Oxazosulfyl is a potent agricultural fungicide. Oxazosulfyl can be used as an insecticide against major rice pests[1].

• HY-W016969R

  2-Undecanone (Standard)	Inhibitor

• HY-P5553

  cPcAMP1/26	Inhibitor
  cPcAMP1/26 is an antimicrobial peptide. cPcAMP1/26 effectively kills A.hydrophila and S. aureus. cPcAMP1/26 induces depolarization of the bacterial plasma membrane, and increases intracellular ROS levels[1].

• HY-139654

  α/β-Hydrolase-IN-1	Inhibitor
  α/β-Hydrolase-IN-1 exhibits the best-in-class MICs of 50 μM (25 μg/mL) and 16 μM (8.4 μg/mL) against M. smegmatis and M. tuberculosis H37Ra, respectively.

• HY-19421

  Orazamide	Inhibitor
  Orazamide is an AICA orotate. Orazamide can prevent anti-TB drug-induced liver damage by downregulating the protein expression of HMGB 1 and RAGE in liver tissue and inhibiting the secretion of inflammatory factors. Orazamide can be used in research on hepatitis and liver cirrhosis[1].

• HY-17504R

  Rosuvastatin (Calcium) (Standard)		99.94%
  Rosuvastatin (Calcium) (Standard) is the analytical standard of Rosuvastatin (Calcium). This product is intended for research and analytical applications. Rosuvastatin Calcium is a competitive HMG-CoA reductase (HMGCR) inhibitor, with an IC50 of 11 nM. Rosuvastatin Calcium potently blocks hERG current with an IC50 of 195 nM[2]. Rosuvastatin Calcium reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin Calcium effectively lowers low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels[1][2][3].

• HY-B1864

  Kasugamycin
  Kasugamycin (Ksg) is an antibiotic which binds both the 30S and 70S ribosome but not isolated 50S subunits. Kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation[1].

• HY-B0526R

  Flumequine (Standard)	Inhibitor
  Flumequine (Standard) is the analytical standard of Flumequine. This product is intended for research and analytical applications. Flumequine (R-802) is a quinolone antibiotic, and acts as a topoisomerase II inhibitor, with an IC50 of 15 μM (3.92 μg/mL).

• HY-N15344

  Euryachin E	Inhibitor
  Euryachin E is an antimicrobial and antiviral agent found in Eurya chinensis. It exhibits a MIC of 6.25 μg/mL against B. cereus and 0.78 μg/mL against S. aureus. Its IC50 against COVID-19 is 6.41 μM. Euryachin E can be utilized for research in the fields of infection and inflammation[1].

• HY-101048

  Synthalin A sulfate	Inhibitor
  Synthalin A sulfate is a biguanylated diamine with antibacterial and hypoglycemic properties. Synthalin A sulfate against S. aureus with a MIC of 64 μg/mL[1].

• HY-17507CS

  (R)-(+)-Pantoprazole-d6
  (R)-(+)-Pantoprazole-d6 is deuterium labeled (R)-(+)-Pantoprazole.

• HY-N1469

  Kaurenoic acid	Inhibitor
  Kaurenoic acid is a diterpene derived from Sphagneticola trilobata. Kaurenoic acid has antibacterial, anti-inflammatory, anticonvulsant, analgesic, and aortic vasodilating effects[1][2][3][4].

• HY-N0006

  Demethoxycurcumin	Inhibitor
  Demethoxycurcumin is one of the main active ingredients of curcumin, which has anti-inflammatory, antioxidant, antibacterial, anti-cancer and neuroprotective effects. Demethoxycurcumin is orally active. Demethoxycurcumin can be used in inflammation, cancer and Alzheimer's disease research[1][2][3][4][5].

• HY-P5547

  Lynronne-3	Inhibitor
  Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection[1]

• HY-123315

  Sulfaperin	Inhibitor	99.87%
  Sulfaperin (Methylsulfadiazin) is an antibacterial agent[1].

• HY-138548

  4-Ethoxycoumarin	Inhibitor
  4-Ethoxycoumarin is an antimicrobial[1].

• HY-P5734

  Bactenecin 5	Inhibitor
  Bactenecin 5 is a bovine antibacterial peptide. Bactenecin 5 is active against Escherichia coli, Salmonella typhimurium, and Klebsiella pneumoniae. T, with MIC values of 12-25 μg/mL[1].

• HY-14743B

  Golotimod hydrochloride	Inhibitor	99.79%
  Golotimod hydrochloride (SCV 07 hydrochloride), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod hydrochloride (SCV 07 hydrochloride) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod hydrochloride (SCV 07 hydrochloride) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2)[1][2][3].

• HY-N6871

  Abietic acid	Inhibitor
  Abietic acid, an orally active diterpene isolated from Colophony, displays significant anti-proliferative, anti-inflammatory, anti-obesity effect, bacteriostatic, cell cycle arresting and pro-apoptotic activities. Abietic acid inhibits lipoxygenase activity for allergy. Abietic acid enhances cell migration and tube formation in HUVECs. Abietic acid induces significant angiogenic potential, which is associated with upregulation of extracellular signal-regulated kinase (ERK) and p38 expression. Abietic acid attenuates sepsis-induced lung injury by inhibiting nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) pathway to inhibit M1 macrophage polarization. Abietic acid exhibits a positive effect against liver injury by attenuating inflammation and ferroptosis. Abietic acid shows accelerated wound closure in a mouse model of cutaneous wounds. Abietic acid significantly reduces the proliferation and growth of NSCLC cells by IKKβ inhibition.Additionally, Abietic acid ameliorates psoriasis-like inflammation and modulates gut microbiota in mice. Abietic acid is promising for research in non-small-cell lung cancer (NSCLC), liver injury-related deseases and psoriasis[1][2][3][4][5][6][7].

• HY-N0610

  Trans-Cinnamic acid	Inhibitor
  trans-Cinnamic acid is a natural antimicrobial, with minimal inhibitory concentration (MIC) of 250 μg/mL against fish pathogen A. sobria, SY-AS1[1].

• HY-161935

  6-(12-Tridecene-1-yl)-2,4-Dihydroxy benzoic acid	Inhibitor
  6-(12-Tridecene-1-yl)-2,4-Dihydroxy benzoic acid (Compound 2) exhibits antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA) and Vancomycin enterococci (VRE). 6-(12-Tridecene-1-yl)-2,4-Dihydroxy benzoic acid interfers with the integrity and function of the bacterial cell membrane, and affects metabolism in MRSA. 6-(12-Tridecene-1-yl)-2,4-Dihydroxy benzoic acid exhibits anti-inflammatory and anti-infective efficacy, and promotes angiogenesis in mice[1].

• HY-N7643

  Comanthoside B	Inhibitor	98.09%
  Comanthoside B is a flavonoid glycoside isolated from the aerial portions of Ruellia tuberosa L. Comanthoside B has anti-inflammatory and antiseptic activities[1].

• HY-158141

  BRD1401	Inhibitor
  BRD1401 is a small molecule targeting the outer membrane protein OprH. BRD1401 disrupts the interaction of OprH with LPS. BRD1401 can increase membrane fluidity[1].

• HY-B1466R

  Mezlocillin (sodium) (Standard)	Inhibitor

• HY-B1166

  Cefamandole nafate	Inhibitor
  Cefamandole nafate (Cefamandole formate sodium) is a second-generation broad-spectrum cephalosporin antibiotic[1].

• HY-N3353

  Luteone	Inhibitor	98.65%
  Luteone is a natural isoflavone, with antioxidant, antibacterial and antifung activities[1].

• HY-13662

  Lansoprazole	Inhibitor
  Lansoprazole (AG 1749) is an orally active proton pump inhibitor which prevents the stomach from producing acid. Lansoprazole (AG 1749) is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[1][2].

• HY-138671

  DprE1-IN-4	Inhibitor
  DprE1-IN-4 is a potent and orally active noncovalent DprE1 inhibitor with an IC50 of 0.90 μg/mL. DprE1-IN-4 exhibits potent in vitro activity against M. tuberculosis H37Rv and drug-resistant tuberculosis strain with MIC values of 0.12 μg/mL and 0.24 μg/mL, respectively. DprE1-IN-4 displays acceptable pharmacokinetic property and shows significant bactericidal activity in an acute mouse model of tuberculosis.

• HY-B0113A

  Omeprazole sodium	Inhibitor	99.98%
  Omeprazole sodium (H 16868 sodium), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole sodium shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM[1]. Omeprazole sodium also inhibits growth of Gram-positive and Gram-negative bacteria[2]. Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[3].

• HY-B1148R

  Furaltadone (hydrochloride) (Standard)	Inhibitor
  Furaltadone (hydrochloride) (Standard) is the analytical standard of Furaltadone (hydrochloride). This product is intended for research and analytical applications. Furaltadone hydrochloride, a nitrofuran agent, has the potential for the study in infections of chickens with salmonella enteritidis. Furaltadone is inhibitory and bactericidal in vitro for staphylococci [1][2].

• HY-N6681

  15-Acetoxyscirpenol	Inhibitor	99.35%
  15-acetoxyscirpenol, one of acetoxyscirpenol moiety mycotoxins (ASMs), strongly induces apoptosis and inhibits Jurkat T cell growth in a dose-dependent manner by activating other caspases independent of caspase-3[1].

• HY-W011539

  EcMetAP1-IN-1	Inhibitor
  EcMetAP1-IN-1 (compound 4) is an inhibitor of Escherichia coli methionine aminopeptidase MetAP1[1].

• HY-N0538S2

  Xylitol-5-13C
  Xylitol-5-13C is the 13C labeled Xylit[1][2].

• HY-P1926

  A-54556A	Inhibitor
  A-54556A (ADEP 1) is an acyldepsipeptide (ADEP) antibiotic. A-54556A shows antibacterial activity against a broad range of Gram-positive bacteria[1].

• HY-N7378A

  N-Hydroxypipecolic acid potassium
  N-Hydroxypipecolic acid potassium (1-Hydroxy-2-piperidinecarboxylic acid potassium), a plant metabolite and a systemic acquired resistance (SAR) regulator, orchestrates SAR establishment in concert with the immune signal salicylic acid. N-Hydroxypipecolic acid potassium accumulates systemically in the plant foliage in response to pathogen attack. N-Hydroxypipecolic acid potassium induces SAR to bacterial and oomycete infection[1][2][3].

• HY-N0055R

  Chlorogenic acid (Standard)	Inhibitor
  Chlorogenic acid (Standard) is the analytical standard of Chlorogenic acid. This product is intended for research and analytical applications. Chlorogenic acid is a major phenolic compound in Lonicera japonica Thunb. It is an orally active antioxidant activity, antibacterial, hepatoprotective, cardioprotective, anti-inflammatory, antipyretic, neuroprotective, anti-obesity, antiviral, anti-microbial, anti-hypertension compound[1][2][3].

• HY-160644

  8PC
  8PC is a the ligand of InhA-NADH-JPM, and can be used for study of tuberculosis[1].

• HY-W016473

  Adamantane-carboxylic acid	Inhibitor
  Adamantane-carboxylic acid is an antibacterial agent that is effective in inhibiting the growth of Gram-positive bacteria but is less sensitive to Gram-negative bacteria[1].

• HY-N0113S

  Hordenine-d6	Inhibitor	98.03%
  Hordenine-d6 (Ordenina-d6) is the deuterium labeled Hordenine. Hordenine, an alkaloid found in plants, inhibits melanogenesis by suppression of cyclic adenosine monophosphate (cAMP) production[1].

• HY-163331

  Cresomycin	Inhibitor
  Cresomycin is a bridged macrobicyclic antibiotic that can bind to the bacterial ribosome. Cresomycin exhibits efficacy against both Gram-positive and Gram-negative bacteria, including multidrug-resistant strains of Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa[1].

• HY-B1434

  7-Aminocephalosporanic acid	Inhibitor
  7-aminocephalosporanic acid (7-ACA) is a HSP90β inhibitor and an antibiotic. 7-Aminocephalosporanic acid is the core chemical structure of the synthesis of cephalosporin antibiotics and an effective β-lactamase inhibitor[1][2].

• HY-P10816

  PACE4 Inhibitory peptide C23
  PACE4 Inhibitory peptide C23 (Compound C23; Ac-(DLeu)LLLRVK-Amba)), a potent peptidomimetic inhibitor, is a PACE4 inhibitor. PACE4 Inhibitory peptide C23e shows antiproliferative effects against PCa cell lines (Ki = 5 nM; IC50 = 25 and 40 μM for DU145 and LNCaP, respectively). PACE4 Inhibitory peptide C23 also blocks tumor growth in vivo in LNCaP xenograft-bearing mice[1].

• HY-B0947

  Sulfanitran	Inhibitor	99.83%
  Sulfanitran is an antibacterial and anticoccidial agent used in poultry feeds. Sulfanitran also is a multidrug resistance protein 2 (MRP2) stimulator that can increase the affinity of MRP2 for estradiol-17-β-D-glucuronide (E217βG)[1][2].

• HY-B0900

  Anethole	Inhibitor	99.78%
  Anethole is a type of orally active aromatic compound that is widely found in nature and used as a flavoring agent. Anethole possesses anticancer, anti-inflammatory, antioxidant, antibacterial, antifungal, anesthetic, estrogenic, central nervous system depressant, hypnotic, insecticidal, and gastroprotective effects. Anethole can be used in the study of oxidative stress-related skin diseases and prostate cancer[1][2][3][4][5].

• HY-W011117

  Danofloxacin	Inhibitor	98.47%
  Danofloxacin is a third generation fluoroquinolone and orally active antimicrobial agent. Danofloxacin shows a broad spectrum of activity against most Gram-negative and Gram-positive bacteria, mycoplasma and chlamydia species, and plays an antimicrobial role by inhibition of bacterial DNA-gyrase. Danofloxacinh has the potential for respiratory diseases in cattle, swine, and chickens treatment[1][2].

• HY-N2876

  Anisofolin A	Inhibitor
  Anisofolin A is a flavonoid that can be isolated from Anisomeles indica. Anisofolin A has antimalarial activity (IC50: 4.39 μM), and antimycobacterium activity (IC50: 4.50 μM) against M. tuberculosis H37Ra[1].

• HY-121054

  Chalcone	Inhibitor	99.98%
  Chalcone is isolated from Glycyrrhiza uralensis and used to synthesize chalcone derivatives. Chalcone derivatives possess varied biological and pharmacological activity, including anti-inflammatory, antioxidative, antibacterial, anticancer, and anti-parasitic activities[1].

• HY-B0633D

  Hyaluronic acid sodium (MW 200-1560)		99.41%
  Hyaluronic acid sodium (MW 200-1560) is a biopolymer composed of repeating disaccharide units with a molecular weight of 1000-2000. Hyaluronic acid sodium (MW 200-1560) has a wide range of applications[1].

• HY-121348

  Ficellomycin	Inhibitor
  Ficellomycin is a nitrogen-containing bicyclic antibiotic with strong activity against Gram-positive bacteria, including multidrug-resistant strains of Staphylococcus aureus. Ficellomycin works by inducing the formation of defective 34S DNA fragments, which interfere with the semi-conservative DNA replication process. These fragments lack the ability to integrate into larger DNA segments and eventually form a complete bacterial chromosome. Ficellomycin can be used in research for various bacterial diseases[1].

• HY-111023

  Nemonoxacin malate	Inhibitor	99.43%
  Nemonoxacin (TG-873870) malate is a nonfluorinated quinolone antibiotic. Nemonoxacin malate has broad-spectrum activity against Gram-positive, Gram-negative and atypical pathogens. Nemonoxacin malate can inhibit drug-resistant Streptococcus pneumoniae and (HY-121544) Methicillin-resistant Staphylococcus aureus. Nemonoxacin malate can be used for the research of community-acquired pneumonia[1][2].

• HY-B1075

  Fosfomycin calcium	Inhibitor
  Fosfomycin (MK-0955) calcium is a blood-brain barrier penetrating, broad-spectrum antibiotic by irreversibly inhibiting an early stage in cell wall synthesis. Fosfomycin calcium shows both in vivo and in vitro activity against a wide range of bacteria, including multidrug-resistant (MDR), extensively drug-resistant (XDR), and pan-drug-resistant (PDR) bacteria[1][2].

• HY-111391R

  Resazurin (sodium) (Standard)	Inhibitor
  Resazurin (sodium) (Standard) is the analytical standard of Resazurin (sodium). This product is intended for research and analytical applications. Resazurin sodium (Diazoresorcinol sodium) is commonly used to measure bacterial and eukaryotic cell viability through its reduction to the fluorescent product resorufin.

• HY-B0030R

  D-Cycloserine (Standard)	Inhibitor
  D-Cycloserine (Standard) is the analytical standard of D-Cycloserine. This product is intended for research and analytical applications. D-Cycloserine is an antibiotic which targets sequential bacterial cell wall peptidoglycan biosynthesis enzymes. D-Cycloserine is a partial NMDA agonist that can improve cognitive functions. D-Cycloserine can be used for multidrug-resistant tuberculosis research[1][2].

• HY-P5704

  K11	Inhibitor
  K11 is an antimicrobial peptide. K11 is active against MDR/XDR K. pneumoniae isolates (MIC: 8-512 μg/mL), and inhibits bacterial biofilm formation. K11 can act synergistically with antibiotics (Chloramphenicol (HY-B0239), Meropenem (HY-13678), Rifampicin (HY-B0272), etc.) against drug-resistant K. pneumoniae. K11 has high thermal and wide pH stability[1].

• HY-143643

  Antibacterial agent 72
  Antibacterial agent 72 displays the antibacterial activities by targeting the bacterial membrane.

• HY-146503

  Antibacterial agent 86
  Antibacterial agent 86 (Compound A11) is the most active and displays bacteriostatic activities against methicillin-resistant S. aureus, with MIC values as low as 0.00191 μg/mL, which is 162 and 32 times lower than that of the marketed antibiotics tiamulin and retapamulin, respectively[1].

• HY-P3911

  CAP 37 (20-44)
  CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein[1].

• HY-Y1825

  Benzimidazole	Inhibitor
  Benzimidazole is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

• HY-B1282S

  Sulfaquinoxaline-d4	Inhibitor
  Sulfaquinoxaline-d4 is the deuterium labeled Sulfaquinoxaline. Sulfaquinoxaline is an antimicrobial for veterinary use, with activity against a broad spectrum of Gram-negative and Gram-positive bacteria. Sulfaquinoxaline is used to prevent coccidiosis and bacterial infections[1][2].

• HY-76210R

  5-Hydroxypyrazine-2-Carboxylic Acid (Standard)	Inhibitor
  Geniposidic acid (Standard) is the analytical standard of Geniposidic acid. This product is intended for research and analytical applications. Geniposidic acid has radiation protection and anti-cancer activity.

• HY-N2010R

  Methyl gallate (Standard)	Inhibitor
  Methyl gallate (Standard) is the analytical standard of Methyl gallate. This product is intended for research and analytical applications. Methyl gallate is a plant phenolic with antioxidant, anticancer, and anti-inflammatory activities. Methyl gallate also shows bacterial inhibition activity. Methyl gallate also has anti-HIV-1 and HIV-1 enzyme inhibitory activities.

• HY-B1340S

  Carbadox-d3	Inhibitor
  Carbadox-d3 is the deuterium labeled Carbadox. Carbadox is a quinoxaline-di-N-oxide antibiotic compound which is widely fed to nursery-age pigs to control enteric diseases and improve feed efficiency.

• HY-B0889R

  Ethacridine (lactate monohydrate) (Standard)	Inhibitor
  Ethacridine (lactate monohydrate) (Standard) is the analytical standard of Ethacridine (lactate monohydrate). This product is intended for research and analytical applications. Ethacridine lactate (Acrinol) monohydrate is a widely used antiseptic and abortifacient. Ethacridine lactate monohydrate is effective against Staphylococcus aureus and other gram-positive cocci. Ethacridine lactate monohydrate is also a poly(ADP-ribose) glycohydrolase (PARG) inhibitor[1][2][3].

• HY-W017982

  Kathon 886MW	Inhibitor
  Kathon 886MW is an efficient broad-spectrum biocide suitable for various metalworking fluids[1][2].

• HY-135842R

  Aspoxicillin (Standard)	Inhibitor
  Aspoxicillin (Standard) is the analytical standard of Aspoxicillin. This product is intended for research and analytical applications. Aspoxicillin is a broad-spectrum antimicrobial agent against 68 isolates of Actinobacillus pleuropneumoniae with an MIC90 value of <= 0.05 μg/ml. Aspoxicillin has a long half-life in mouse serum of 55 minutes[1][2].

• HY-134090

  9-Methylstreptimidone
  9-Methylstreptimidone is a microbial metabolite originally isolated from Streptomyces sp. S-885 that has antifungal and antiviral activities. It is active against several fungi, including S. sake, S. fragilis, R. rubra, T. rubra, and C. albidus (MICs=4-20 μg/mL) and has antiviral activity against poliovirus, vesicular stomatitis virus (VSV), and Newcastle disease virus (NDV) in vitro (MIC=0.02 μg/mL for all). 9-Methylstreptimidone increases survival in mouse models of infection with influenza A2 (H2N2) or C. albicans when administered prior to infection.

• HY-13212

  (Z)-2-Decenoic acid
  (Z)-2-decenoic acid (cis-2-Decenoic acid) is an unsaturated fatty acid produced by Pseudomonas aeruginosa. (Z)-2-decenoic acid induces a dispersion response in biofilms formed by a range of gram-negative bacteria, including P. aeruginosa, and by gram-positive bacteria. (Z)-2-decenoic acid inhibits biofilm development[1].

• HY-N0482R

  Phillyrin (Standard)	Inhibitor
  Phillyrin (Standard) is the analytical standard of Phillyrin. This product is intended for research and analytical applications. Phillyrin is isolated from Forsythia suspensa Vahl (Oleaceae), has antibacterial and anti-inflammatory activities. Phillyrin has potential inductive effects on rat CYP1A2 and CYP2D1 activities, without affecting CYP2C11 and CYP3A1/2 activities[1]. Phillyrin has anti-influenza A virus activities[2].

• HY-B1781R

  Sulfachloropyridazine (Standard)	Inhibitor
  Sulfachloropyridazine (Standard) is the analytical standard of Sulfachloropyridazine. This product is intended for research and analytical applications. Sulfachloropyridazine is a broad spectrum sulfonamide used against both Gram-positive and Gram-negative aerobic bacteria.

• HY-B1295

  Lithium citrate tetrahydrate	Inhibitor
  Lithium citrate (Litarex) tetrahydrate is the major active ingredient of Garcinia cambogia. Lithium citrate tetrahydrate competitively inhibits ATP citrate lyase with weight loss benefits. Lithium citrate tetrahydrate effective inhibits stones formation and also inhibits HIF, and has antioxidation, anti-inflammation and anti-tumor effects[1][2][3][4].

• HY-128850S1

  N-Acetyl-D-mannosamine-13C
  N-Acetyl-D-mannosamine-13C is the 13C labeled N-Acetyl-D-mannosamine. N-Acetyl-D-mannosamine (ManNAc) is an essential precursor of N-acetylneuraminic acid (NeuAc), the specific monomer of bacterial capsular polysialic acid (PA)[1][2]

• HY-137335

  6'-Sialyllactose sodium	Inhibitor
  6'-Sialyllactose (sodium), a predominant milk oligosaccharide, reduces the internalisation of Pseudomonas aeruginosa in human pneumocytes[1].

• HY-B0441A

  Tobramycin sulfate	Inhibitor
  Tobramycin sulfate (Nebramycin Factor 6 sulfate) is a parenterally administered, broad spectrum aminoglycoside antibiotic that is widely used in the treatment of moderate to severe bacterial infections due to sensitive organisms[1].

• HY-113582

  Albothricin	Inhibitor
  Albothricin is a potent streptothricin Antibiotic with antimicrobial activities[1].

• HY-N9112

  Eriodictyol 7, 3'-dimethyl ether
  Eriodictyol 7, 3'-dimethyl ether (compound 11) is the first flavonoid extract from B. riparia with antioxidant and antibacterial activity[1].

• HY-128467R

  Dehydroacetic acid (sodium) (Standard)	Inhibitor
  Dehydroacetic acid (sodium) (Standard) is the analytical standard of Dehydroacetic acid (sodium). This product is intended for research and analytical applications. Dehydroacetic acid sodium, a pyrone derivative acts as an antibacterial and antifungal agent. Dehydroacetic acid possess phytotoxic activity[1].

• HY-138137

  Menaquinone 6	Inhibitor
  Menaquinone 6 is a active product found in Wolinella succinogenes. Menaquinone 6 is a form of vitamin K2 (HY-109569) that has antimicrobial activity[1].

• HY-13725

  Pirarubicin	Inhibitor	99.61%
  Pirarubicin is an anthracycline antibiotics, acts as a topoisomerase II inhibitor, and is a widely used for treatment of various cancers, in particular, solid tumors.

• HY-Y0366S5

  Lauric acid-d5	Inhibitor
  Lauric acid-d5 is the deuterium labeled Lauric acid. Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively.

• HY-113897

  Chloramphenicol 3-acetate
  Chloramphenicol 3-acetate is the main intermediate in the biodegradation of CAP, formed by the acetylation of the 3-hydroxy group of CAP through chloramphenicol acetyltransferase, this is a common resistance mechanism that microbes have against chloramphenicol[1].

• HY-B1282

  Sulfaquinoxaline	Inhibitor
  Sulfaquinoxaline is an antimicrobial for veterinary use, with activity against a broad spectrum of Gram-negative and Gram-positive bacteria. Sulfaquinoxaline is used to prevent coccidiosis and bacterial infections[1][2].

• HY-157433

  Mab-SaS-IN-1	Inhibitor
  Mab-SaS-IN-1 (compoud 1H) is Mab-SaS inhibitor with the IC50 of 2 μM. Mab-SaS-IN-1 can be used for study of antibiosis by blocking iron uptake and metabolism[1].

• HY-147059R

  Dieckol (Standard)
  Buclizine (dihydrochloride) (Standard) is the analytical standard of Buclizine (dihydrochloride). This product is intended for research and analytical applications. Buclizine dihydrochloride is an orally active antihistamine antiallergic compound. Buclizine dihydrochloride is a potent teratogen in the rat and shows anti-tumor activity[1][2][3].

• HY-19581R

  Baquiloprim (Standard)	Inhibitor
  Baquiloprim (Standard) is the analytical standard of Baquiloprim. This product is intended for research and analytical applications. Baquiloprim, an antibiotic, is a selective inhibitor of bacterial dihydrofolate reductases. Baquiloprim possesses in vitro bacteriostatic activity against both Gram-negative and Gram-positive bacteria[1][2].

• HY-111278R

  Pyocyanin (Standard)	Inhibitor

• HY-B0902AR

  Rufloxacin hydrochloride (Standard)	Inhibitor
  Rufloxacin hydrochloride (Standard) is the analytical standard of Rufloxacin hydrochloride. This product is intended for research and analytical applications. Rufloxacin hydrochloride (MF-934 hydrochloride) is a fluoroquinolone antibacterial, inhibits B-cell differentiation in human mononuclear cells, inhibits Topo.

• HY-100306

  PNU-176798	Inhibitor
  PNU-176798 is an antimicrobial agent, targeting protein synthesis in a wide spectrum of gram-positive and anaerobic bacteria.

• HY-N0683S

  2-ambo-Vitamin E-13C6	Inhibitor
  α-Vitamin E-13C6 is the 13C-labeled α-Vitamin E. α-Vitamin E ((+)-α-Tocopherol), a naturally occurring vitamin E form, is a potent antioxidant[1][2].

• HY-135221A

  Cefcapene pivoxil	Inhibitor
  Cefcapene pivoxil, the pivalate ester prodrug form of Cefcapene, is an orally active third-generation cephalosporin with a wide spectrum of anti-bacterial activity. Cefcapene has the potential for the palmoplantar pustulosis (PPP) research[1][2].

• HY-B0334AS

  Sulbactam-d5 sodium	Inhibitor
  Sulbactam-d5 (sodium) is the deuterium labeled Sulbactam sodium. Sulbactam (CP45899) sodium is a competitive, irreversible beta-lactamase inhibitor. Sulbactam sodium shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus--Acinetobacter baumannii (Acb) complex[1][2].

• HY-119022

  MAC-0547630
  MAC-0547630 is a potent inhibitor of undecaprenyl diphosphate synthase (UppS), with IC50s of 0.05 μM and 1.6 μM for UppSBS and UppSBA, respectively. MAC-0547630 is active against B. subtilis in vitro (MIC 0.1 ng/mL)[1].

• HY-B0529R

  Azlocillin (Standard)	Inhibitor
  Azlocillin (Standard) is the analytical standard of Azlocillin. This product is intended for research and analytical applications. Azlocillin, an antibiotic, is a semisynthetic penicillin, and has broad-spectrum antibacterial activity. Azlocillin is active against drug-tolerant B. burgdorferi sensu stricto JLB31 infection[1][2].

• HY-17591S

  Penicillin G-d5 potassium	Inhibitor	98.67%
  Penicillin G-d5 (potassium) is the deuterium labeled Penicillin G potassium. Penicillin G potassium is a fast-acting antibiotic; used to treat bacterial infections that affect the blood, heart, lungs, joints, and genital areas[1][2].

• HY-146595

  FtsZ-IN-1	Inhibitor
  FtsZ-IN-1 is a potent FtsZ inhibitor with quinolinium ring. FtsZ-IN-1 has stronger antibacterial activity against Gram-positive bacteria with MICs of 0.5-8 μg/mL. FtsZ-IN-1 significantly causes cell elongation of B. subtilis by enhancing FtsZ polymerization. FtsZ-IN-1 exhibits low hemolytic toxicity and low tendency to induce agent resistance. FtsZ-IN-1 has against drug-resistant bacteria activity[1].

• HY-U00214

  Ibafloxacine	Inhibitor
  Ibafloxacine (R835) is a fluoroquinolone antibiotic agent that is developed exclusively for veterinary use.

• HY-122146

  Bactobolin B	Inhibitor
  Bactobolin B (Alanylbactobolin) is a chlorine-containing antibiotic with antitumor activities[1].

• HY-115448A

  Bio-AMS TFA	Inhibitor
  Bio-AMS (TFA) is a potent bacterial biotin protein ligase inhibitor. Bio-AMS (TFA) possesses selective activity against Mycobacterium tuberculosis (Mtb) and arrests fatty acid and lipid biosynthesis[1].

• HY-101479R

  Iclaprim (Standard)	Inhibitor
  Iclaprim (Standard) is the analytical standard of Iclaprim. This product is intended for research and analytical applications. Iclaprim is a new selective bacterial Dihydrofolate inhibitor, which can inhibit the growth of S. aureus (MRSA) with an MIC90 of 0.06 μg/mL.

• HY-B0322S

  Sulfamethoxazole-d4	Inhibitor
  Sulfamethoxazole-d4 is a deuterium labeled Sulfamethoxazole (Ro 4-2130). Sulfamethoxazole is a sulfonamide bacteriostatic antibiotic[1].

• HY-17466

  Sancycline	Inhibitor	98.01%
  Sancycline (6-Demethyl-6-deoxytetracycline) acts by reversibly binding to the 30 S ribosomal subunit and inhibiting protein translation by blocking entry of aminoacyl-tRNA into the ribosome a site similar to tetracycline (HY-A0107). Sancycline, four linearly fused six-membered rings with four stereocenters, is a rare semi-synthetic tetracycline (HY-A0107) prepared by hydrogenolysis of the chloro and benzylic hydroxy moieties of Declomycin[1][2][3].

• HY-133592R

  Neoabietic acid (Standard)	Inhibitor
  Neoabietic acid (Standard) is the analytical standard of Neoabietic acid. This product is intended for research and analytical applications. Neoabietic acid, an abietic-type acid, is a nature product that could be isolated from the oleoresin and rosin of Pinus palustris. Neoabietic acid is highly susceptible to mineral acid. Neoabietic acid has antibacterial activity[1][2][3].

• HY-125576

  Griselimycin	Inhibitor
  Griselimycin is a compound with antituberculosis activity that exhibits good in vitro and in vivo activity against sensitive and resistant Mycobacterium tuberculosis, and its cyclohexyl derivative has high transformative potential.

• HY-133685

  N-Hexanoyl-L-homoserine lactone	Modulator
  N-Hexanoyl-L-homoserine lactone is a short-chained N-acyl homoserine lactone (AHL). N-hexanoyl-L-homoserine lactone is also a mediator of bacterial quorum-sensing regulation. N-hexanoyl-L-homoserine lactone promotes lipid accumulation in algae. AHL is an intercellular communication signal molecule in the quorum sensing system of Gram-negative bacteria and a medium for mediating information exchange between eukaryotic plants and prokaryotic bacteria. AHL can affect bacteria activities, such as biofilm formation, pigment synthesis, and antibiotic synthesis[1][2][3][4].

• HY-141829

  Antibacterial agent 27		98.03%
  Antibacterial agent 27 is a potent antibacterial compound against Candida species[1].

• HY-153009

  MMV676584	Inhibitor	99.82%
  MMV676584 has anti-tuberculosis avtivity. MMV676584 is a novel agent candidate for eumycetoma[1].

• HY-125633

  Kapurimycin A3	Inhibitor
  Kapurimycin A3 is an antitumor and antibacterial antibiotic. Kapurimycin A3 has DNA binding and breakage activity. Kapurimycin A3 can be isolated from Streptomyces[1][2].

• HY-P3981

  Defensin NP-3A	Inhibitor
  Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity[1][2].

• HY-116872

  MAC13772	Inhibitor	99.76%
  MAC13772 is a potent inhibitor of the enzyme BioA (IC50=250 nM), the antepenultimate step in biotin biosynthesis. MAC13772 is a novel antibacterial compound[1].

• HY-100289

  MF 5137	Inhibitor
  MF 5137 is a potent antibacterial agent.

• HY-150554

  Antitubercular agent-29	Inhibitor
  Antitubercular agent-29 (compound 6xa) is a potent agent resistant (DR) Mycobacterium tuberculosis (Mtb) inhibitor with MIC of 0.03 μg/mL against agent-susceptible (DS)-Mtb strains, MIC of 0.03-0.06 μg/mL against DR-Mtb strains, and favourable selectivity (SI>40) against Vero cells[1].

• HY-W012037R

  8-Hydroxyquinoline (hemisulfate) (Standard)	Inhibitor
  8-Hydroxyquinoline (hemisulfate) (Standard) is the analytical standard of 8-Hydroxyquinoline (hemisulfate). This product is intended for research and analytical applications. 8-Hydroxyquinoline hemisulfate (8-Quinolinol hemisulfate) is a monoprotic bidentate chelating agent, exhibits antiseptic, disinfectant, and pesticide properties, functioning as a transcription inhibitor.

• HY-B1599

  Chloramphenicol palmitate	Inhibitor	98.25%
  Chloramphenicol palmitate is an orally active broad spectrum antibiotic and has a broad spectrum of activity against gram positive and gram negative bacteria. Chloramphenicol palmitate inhibits bacterial protein synthesis by blocking the peptidyl transferase step. Chloramphenicol palmitate can be used as bacterial selection agent in transformed cells containing chloramphenicol resistance genes[1].

• HY-79635

  Methyl indole-3-carboxylate	Inhibitor	99.89%
  Methyl indole-3-carboxylate is a natural product isolated from Sorangium cellulosum strain Soce895. Methyl indole-3-carboxylate shows a weak activity against the Gram-positive Nocardia sp with a MIC value of 33.33 μg/mL[1].

• HY-N13910

  Alnumycin	Inhibitor
  Alnumycin is a naphthoquinone antibiotic with a narrow-spectrum antimicrobial activity against Gram-positive bacteria. Alnumycin inhibits the growth of K562 human leukemia cells with an IC50 of 0.53 μg/mL[1].

• HY-P10724

  fMIFL
  fMIFL is an FPR1 agonist. fMIFL can activate several signaling pathways responsible for various neutrophil functions, such as adhesion, chemotaxis, secretion of granule exocytosis, and the production of superoxide anions. fMIFL can be used in research on bacterial infections and tissue damage[1].

• HY-B1218

  Sulfaphenazole	Inhibitor
  Sulfaphenazole is a selective inhibitor of human cytochrome P450 (CYP) 2C9 enzyme. Sulfaphenazole is a cytoprotective agent against light-induced death of photoreceptors. Sulfaphenazole inhibits light-induced necrosis and mitochondrial stress-initiated apoptosis. Sulfaphenazole is an off patent sulfonamide antibiotic and demonstrates bactericidal activity through enhanced M1 macrophage activity. Sulfaphenazole can significantly reduce infarct size and restore post-ischemic coronary flow following ischemia and reperfusion[1][2][3].

• HY-N8401

  Musellactone	Inhibitor
  Musellactone is a lactone that can be isolated from Musella lasiocarpa. Musellactone is an antibiotic, that exhibits antibacterial activity against Bacillus megaterium and Sarcina lutea[1].

• HY-170520

  Antibiofilm agent-14	Inhibitor
  Antibiofilm agent-14 (compound 11) is an antibiofilm agent. Antibiofilm agent-14 has antifungal activity against C.albicans SC5314 with MIC of 50 μM[1].

• HY-B0810

  Pivmecillinam	Inhibitor
  Pivmecillinam (FL-1039) is an orally active proagent of mecillinam, an extended-spectrum penicillin antibiotic.

• HY-B1190BS

  L-Cefadroxil-d4 trifluoroacetate
  L-Cefadroxil-d4 (trifluoroacetate) is deuterium labeled L-Cefadroxil.

• HY-N7854

  Anacardic acid diene
  Anacardic acid diene is a polyunsaturated form of anacardic acid (HY-N2020) that has been found in cashew nut shell liquid. It has antibacterial activity against methicillin resistant S. aureus (MRSA) and S. mutans (MICs=12.5 and 6.25 μg/mL, respectively). Anacardic acid diene has schistosomicidal activity against adult S. mansoni worms when used at a concentration of 100 μM. It also inhibits soybean lipoxygenase-1 in a time-dependent manner.

• HY-168500

  Metallo-β-lactamase-IN-16	Inhibitor
  Metallo-β-lactamase-IN-16 (compound 18) is a sulfone containing metallo-β-lactamase inhibitor with an anti-bacterial activity. Metallo-β-lactamase-IN-16 inhibits NDM-1 (New Dehli metallo-β-lactamase-1), IMP-1 (imipenemase-1), VIM-1 (Verona integron-encoded metallo-β-lactamase), and VIM-2 with IC50 values of 0.16 nM, 0.23 nM, 0.31 nM and 1.0 nM, respectively[1].

• HY-N13883

  Aerocavin	Inhibitor
  Aerocavin is an antibiotic that is active against both Gram-positive and Gram-negative bacteria in vitro[1].

• HY-P0261B

  Indolicidin TFA	Inhibitor
  Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils[1].

• HY-78086R

  m-Tolualdehyde (Standard)	Inhibitor
  m-Tolualdehyde (Standard) is the analytical standard of m-Tolualdehyde. This product is intended for research and analytical applications. m-Tolualdehyde (3-Methylbenzaldehyde) is a compound that can be isolated from Ficus carica L. and Myosotis arvensis. m-Tolualdehyde has food protective effects. m-Tolualdehyde shows acaricidal activities for Tyrophagus putrescentiae with a LD50 of 1.97 μg/cm3[1][2].

• HY-P5562

  PP102	Inhibitor
  PP102 is an antimicrobial peptide is active against gram-positive B. subtilis (MIC: 25 uM), S. aureus (MIC: 13.3 uM), S. lutea (MIC: 63 uM), and B. pumilu (MIC: 23 uM)[1].

• HY-155048

  BDM91270	Inhibitor	99.80%
  BDM91270 (compound 29) is an E. coli AcrAB-TolC efflux pump inhibitor with an EC90 of 0.6 μM for wild-type E. coli AcrB. BDM91270 can be used in the study of Escherichia coli drug resistance[1].

• HY-156270

  SDH-IN-9	Inhibitor
  SDH-IN-9 (compound Ip) is a potent inhibitor of Succinate Dehydrogenase. SDH-IN-9 shows fungicidal activity against Fusarium graminearum Schw with the EC50 of 0.93 μg/mL[1].

• HY-123087

  N-(3-Hydroxytetradecanoyl)-DL-homoserine lactone	Inhibitor
  N-(3-Hydroxytetradecanoyl)-DL-homoserine lactone (N-(3-oxodecanoyl)-homoserine lactone) is a member of N-Acyl homoserine lactone (AHL) from V. alginolyticus strains. N-(3-Hydroxytetradecanoyl)-DL-homoserine lactone is used for biofilm formation and has antibacterial activity[1].

• HY-125617

  α-Lipomycin
  α-Lipomycin is an acyclic polyene antibiotic isolated from the gram-positive bacterium Streptomyces aureofaciens Tü117[1].

• HY-P2794

  G0775	Inhibitor
  G0775 is a molecule with potent, broad-spectrum activity against Gram-negative bacteria. G0775 is active against MDR bacteria. G0775 binds the LepB protease domain[1].

• HY-B0330

  Levofloxacin	Inhibitor	99.92%
  Levofloxacin ((-)-Ofloxacin) is an orally active antibiotic and is active against both Gram-positive and Gram-negative bacteria. Levofloxacin inhibits the DNA gyrase and topoisomerase IV. Levofloxacin can be used for chronic periodontitis, airway inflammation and BK Viremia research. Levofloxacin shows anti-orthopoxvirus activity[1][2][3][4][5].

• HY-Y0366S3

  Lauric acid-d3	Inhibitor
  Lauric acid-d33 is the deuterium labeled Lauric acid. Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively.

• HY-W017212S

  Methyl cinnamate-d7	Inhibitor
  Methyl cinnamate-d7 is deuterated labeled Cinnamyl Alcohol (HY-Y0078). Cinnamyl Alcohol is an active component from chestnut flower, inhibits increased PPARγ expression, with anti-obesity activity[1].

• HY-N6580

  Ginsenoside Rg4	Inhibitor	99.94%
  Ginsenoside Rg4 is a major protopanaxatriol type ginsenoside isolated from the leaves of Panax ginseng C. A. Meyer. The protopanaxatriol type ginsenosides (such as Ginsenoside Rg4) exhibits various biological activities including anti-septic, anti-diabetic, wound healing, immune-stimulatory, and anti-antioxidant activity[1][2].

• HY-16955

  Plazomicin	Inhibitor
  Plazomicin (ACHN 490) is a compound with antimicrobial activity similar to gentamicin and amikacin that may have an effect on infant gastrointestinal flora when used during breastfeeding.

• HY-N1952

  Isoeugenol	Inhibitor
  Isoeugenol is an essential oil constituent of nutmeg, clove, and cinnamon. Isoeugenol inhibits growth of Escherichia coli and Listeria innocua with MICs of 0.6 mg/mL and 1 mg/mL, respectively[1].

• HY-130337

  Teicoplanin A2-2	Inhibitor
  Teicoplanin A2-2 is a glycopeptide antibiotic. Teicoplanin A2-2 exhibits antibacterial activity, particularly against coagulase-negative staphylococci (CNS). Teicoplanin A2-2 inhibits bacterial cell wall synthesis by competitively binding to the terminal D-Ala-D-Ala peptide bonds in the cell wall synthesis process, leading to bacterial death. Teicoplanin A2-2 can be used for research into bacterial resistance mechanisms and the development of new antibiotics[1].

• HY-P0263R

  Dermaseptin (Standard)	Inhibitor
  Kanamycin (sulfate) (Standard) is the analytical standard of Kanamycin (sulfate). This product is intended for research and analytical applications. Kanamycin (Kanamycin A) sulfate is an orally active antibacterial (gram-negative/positive bacteria) agent, inhibits translocation and causes misencoding by binding to the 70 S ribosomal subunit. Kanamycin sulfate shows good inhibitory activity to both M. tuberculosis (sensitive and drug-resistant ) and K. pneumonia, which can be used in studies of tuberculosis and pneumonia[1][2][3][4].

• HY-P2292A

  Omiganan, FITC labeled TFA	Inhibitor
  Omiganan, FITC labeled TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections[1].

• HY-P5033

  Cyclo(Gly-His)
  Cyclo(Gly-His) is a liposome-encapsulated cyclic dipeptide with antimicrobial and anticancer activity. Cyclo(Gly-His) has cytotoxicity for HeLa and MCF-7 cell with IC50 values of 1.699 mM and 0.358 mM, respectively. Cyclo(Gly-His) can be used for the research of drug delivery systems[1].

• HY-B0454AS

  Miconazole-d5 nitrate (2,4-Dichlorobenzyloxy-d5)	Inhibitor
  Miconazole-d5 (nitrate) (2,4-Dichlorobenzyloxy-d5) is the deuterium labeled Miconazole nitrate. Miconazole nitrate (R18134 nitrate) is an imidazole antifungal agent. Miconazole nitrate also has antibacterial effects[2].

• HY-N0289

  Lycorine hydrochloride	Inhibitor	99.89%
  Lycorine hydrochloride is the main active ingredient of the herbal medicine derived from Lycoris radiata (L’Her.) Herb. and is also a melanoma vasculogenic inhibitor and has anti-tumor activity[1]. Lycorine hydrochloride effectively inhibits mitotic proliferation of Hey1B cells (IC50 of 1.2 μM)[2].

• HY-P10612

  Tetanus toxin peptide
  Tetanus toxin peptide is a specific peptide isolated from the toxin produced by Clostridium tetani. Tetanus toxin peptide can be used as an immunogen to induce diabetes in mice. Tetanus toxin peptide can be used in the study of type 1 diabetes[1].

• HY-P2522

  Competence-Stimulating Peptide-2 (CSP-2)		98.56%
  Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM[1].

• HY-157345

  Nutrient Agar	Inhibitor
  Nutrient Agar is a special agar for bacterial culture. The composition of 1 litre medium is 33 g Nutrient Agar [1].

• HY-17508R

  Clarithromycin (Standard)	Inhibitor
  Clarithromycin (Standard) is the analytical standard of Clarithromycin. This product is intended for research and analytical applications. Clarithromycin has a broad spectrum of antimicrobial activity. Clarithromycin inhibits the CYP3A4-catalyzed triazolam alpha-hydroxylation with the IC50 (Ki) value of 56 (43) μM[2]. Clarithromycin significantly inhibits the HERG potassium current[3].Clarithromycin affects the autophagic flux by impairing the signaling pathway linking hERG1 and PI3K[4].

• HY-144259

  Metallo-β-lactamase-IN-2	Inhibitor
  Metallo-β-lactamase-IN-4 (compound 40) is a potent metallo-β-lactamases (MBL) inhibitor, with IC50 values of 0.1 μM (VIM-1), 1.3 μM (NDM-1), and 5.0 μM (IMP-7), respectively[1].

• HY-W012634R

  Benzothiazole (Standard)	Inhibitor
  Benzothiazole (Standard) is the analytical standard of Benzothiazole. This product is intended for research and analytical applications. Benzothiazole is a natural occurring heterocyclic nuclei. Benzothiazole nucleus possesses a number of biological activities such as anticancer, antimicrobial, antidiabetic, anti-inflammatory, antileishmanial, and antiviral. Furthermore, Benzothiazole nucleus can function as an efficacious β-amyloid imaging agent[1][2][3][4].

• HY-161586

  Chloramphenicol/BSA	Inhibitor
  Chloramphenicol/BSA is the antigen-adjuvant conjugate formed by the coupling of Chloramphenicol (HY-B0239) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.

• HY-17409R

  Nystatin (Standard)
  Nystatin (Standard) is the analytical standard of Nystatin. This product is intended for research and analytical applications. Nystatin is an orally active polyene antifungal antibiotic effective against yeast and mycoplasma. Nystatin increases the permeability of plasma membranes to small monovalent ions, including chloridion[1][2]. Nystatin is a cholesterol-sequestering agent[3], partially prevents Oxaliplatin-induced lipid raft aggregation, DR4 and DR5 clustering, and thereby reduces apoptosis[5].

• HY-P2148

  P-113	Inhibitor	98.59%
  P-113 is an antimicrobial peptide (AMP) derived from the human salivary protein histatin 5. P-113 is active against clinically important microorganisms such as Pseudomonas spp., Staphylococcus spp., and C. albicans[1].

• HY-P1568

  Flagelin 22	Agonist
  Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae[1][2][3].

• HY-118448R

  2,4-Diacetylphloroglucinol (Standard)
  Tetrachlorvinphos (Standard) is the analytical standard of Tetrachlorvinphos. This product is intended for research and analytical applications. Tetrachlorvinphos is an organophosphorus pesticide that has the activity of inhibiting cholinesterase. Tetrachlorvinphos is used as a pesticide, mainly for the control of pests. Tetrachlorvinphos has low toxicity to mammals[1].

• HY-B1484R

  Moxalactam (sodium salt) (Standard)	Inhibitor
  Moxalactam (sodium salt) (Standard) is the analytical standard of Moxalactam (sodium salt). This product is intended for research and analytical applications. Moxalactam (Latamoxef) sodium salt is a synthetic oxa-β-lactam antibiotic. Moxalactam sodium salt has a broad spectrum of activity against Gram-positive and Gram-negative aerobic and anaerobic bacteria. Moxalactam sodium salt inhibits production of β-lactamases[1].

• HY-W268334

  1,2,3,4-Tetrahydronorharman-1-one	Inhibitor
  1,2,3,4-Tetrahydronorharman-1-one is a manzamine alkaloid with activity against infectious and tropical parasitic diseases from an Indonesian sponge[1].

• HY-W016420

  Fosfomycin sodium	Inhibitor
  Fosfomycin (MK-0955) sodium is a blood-brain barrier penetrating, broad-spectrum antibiotic by irreversibly inhibiting an early stage in cell wall synthesis. Fosfomycin sodium shows both in vivo and in vitro activity against a wide range of bacteria, including multidrug-resistant (MDR), extensively drug-resistant (XDR), and pan-drug-resistant (PDR) bacteria[1][2].

• HY-P4746

  LL-37 FKR	Inhibitor
  LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance[1][2].

• HY-129673

  Sarubicin A	Inhibitor
  Sarubicin A (U-58431) is an antibiotic that inhibits Gram-positive and Gram-negative bacteria and has antitumor activity[1][2].

• HY-155491

  Antibacterial agent 166	Inhibitor
  Antibacterial agent 166 (Compound 19q), a derivative of Nitisinone (HY-B0607), is a selective and orally active Fusobacterium nucleatum inhibitor with a MIC50 of 1 μg/mL. Antibacterial agent 166 effectively attenuates the migratory ability of MC-38 cells induced by Fusobacterium nucleatum. Antibacterial agent 166 is a promising anti-F. nucleatum lead compound and can be used for colorectal cancer (CRC) research[1].

• HY-N6687

  Calcimycin	Inhibitor
  Calcimycin (A-23187) is an antibiotic and a unique divalent cation ionophore (like calcium and magnesium). Calcimycin induces Ca2+-dependent cell death by increasing intracellular calcium concentration. Calcimycin inhibits the growth of Gram-positive bacteria and some fungi. Calcimycin also inhibits the activity of ATPase and uncouples oxidative phosphorylation (OXPHOS) of mammalian cells. Calcimycin induces apoptosis[1][2][3][4].

• HY-129329

  Lankamycin
  Lankamycin, a macrolide antibiotic, shows moderate antimicrobial activity against several gram-positive bacteria, acting as a synergistic pair with carbocyclic antibiotic Lankacidin C (HY-121412) by binding to the ribosome exit tunnel[1].

• HY-P2454

  CSP1	Inhibitor	98.26%
  CSP1 is a potent and selective ComD1 receptor agonist, with an IC50 of 10.3 nM. CSP1 is a major variants of competence-stimulating peptide (CSP), and it can regulate genetic transformation of S. pneumonia by modulating quorum sensing (QS). CSP1 can act as an antibacterial agent[1][2].

• HY-155332

  AB131	Inhibitor
  AB131 is a MSMEG 6649 and Rv2172c inhibitor (Kd: 0.16 and 0.02 μM respectively). AB131 can sensitize the antimycobacterial activity of the antitubercular agent[1].

• HY-B1920R

  Josamycin (Standard)	Inhibitor
  Josamycin (Standard) is the analytical standard of Josamycin. This product is intended for research and analytical applications. Josamycin (EN-141) is an orally active macrolide antibiotic exhibiting antimicrobial activity against a wide spectrum of pathogens, such as bacteria. The dissociation constant Kd from ribosome for Josamycin is 5.5 nM[1][2].

• HY-100126

  Tubercidin	Inhibitor
  Tubercidin (7-Deazaadenosine) is an antibiotic obtained from Streptomyces tubercidicus. Tubercidin inhibits the growth of Streptococcus faecalis (8043) with an IC50 of 0.02 μM[1]. Tubercidin inhibits polymerases by incorporating DNA or RNA, thereby inhibiting DNA replication, RNA and protein synthesis[2]. Tubercidin is a weak inhibitor of adenosine phosphorylase, and interferes with the phosphorylation of adenosine and AMP[1]. Tubercidin has antiviral activity[2].

• HY-N1051

  Zarzissine	Inhibitor
  Zarzissine is a cytotoxic guanidine alkaloid that can be isolated from the Mediterranean sponge Anchinoe paupertas. Zarzissine shows antimicrobial and anticancer activities[1].

• HY-17522R

  Meptyldinocap (Standard)	Inhibitor
  Meptyldinocap (Standard) is the analytical standard of Meptyldinocap. This product is intended for research and analytical applications.

• HY-124212

  Thaxtomin A	Chemical	98.7%
  Thaxtomin A is a major phytotoxin produced by S. scabies.

• HY-149155

  o-Cymen-5-ol	Inhibitor
  o-Cymen-5-ol is a broad-spectrum antimicrobial agent with direct antimicrobial activity. o-Cymen-5-ol showed effective minimum inhibitory concentrations (MICs) against a variety of bacteria and fungi, such as Streptococcus mutans and Candida albicans. The combination of o-Cymen-5-ol and zinc showed synergistic effects, enhancing the inhibitory effect against oral pathogens. o-Cymen-5-ol was able to inhibit the glycolysis process and co-enhanced this effect with zinc. o-Cymen-5-ol showed a stronger antibacterial effect in toothpaste than placebo[1].

• HY-Y0682B

  Ethylenediaminetetraacetic acid tetrasodium	Inhibitor
  Ethylenediaminetetraacetic acid (EDTA) tetrasodium is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid tetrasodium has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid tetrasodium decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid tetrasodium can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid tetrasodium can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-N4314

  Scutellarein tetramethyl ether	Inhibitor	99.93%
  Scutellarein tetramethyl ether (4',5,6,7-Tetramethoxyflavone) is a bioactive compound extracted from Eupatorium odoratum. Scutellarein tetramethyl ether exhibits anti-inflammatory, antibacterial, pro-coagulant, and anti-tumor activities. Scutellarein tetramethyl ether exerts its anti-inflammatory effects by modulating the NF-κB pathway and regulates bacterial resistance through the inhibition of efflux pumps. Additionally, Scutellarein tetramethyl ether accelerates coagulation time via the endogenous coagulation pathway. Studies have shown that Scutellarein tetramethyl ether can effectively inhibit the growth of the liver cancer cell line HepG2 (IC50= 20.08 μg/mL)[1][2][3][4].

• HY-B1782R

  Sulfamoxole (Standard)	Inhibitor
  Sulfamoxole (Standard) is the analytical standard of Sulfamoxole. This product is intended for research and analytical applications. Sulfamoxole is a broad- spectrum chemotherapeutic antimicrobial agent. Sulfamoxole can be used for the study of pediatric infections[1].

• HY-B0508S

  Ornidazole-d5	Inhibitor
  Ornidazole-d5 is deuterium labeled Ornidazole.

• HY-N4167

  3-O-Methylgalangin	Inhibitor	99.54%
  3-O-Methylgalangin (Galangin 3-methyl ether) is a natural flavonoid compound from the rhizome of Alpinia officinarum (AO) with antibacterial activities, which also inhibits pancreatic lipase[1][2].

• HY-121473

  Aklavin	Inhibitor
  Aklavin is an antibiotic that shows activity against various bacteriophages, Gram-positive bacteria, and some fungi and viruses[1].

• HY-139776

  Antibacterial agent 59	Inhibitor
  Antibacterial agent 59 (example 24) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-B1741A

  Proflavine dihydrochloride	Inhibitor
  Proflavine (3,6-Diaminoacridine) dihydrochloride, an acridine dye, is a DNA intercalating agent and Anti-microbial agent. Proflavine dihydrochloride behaves as a pore blocker for Kir3.2. Proflavine dihydrochloride is a potential lead compound for Kir3.2-associated neurological diseases[1][2][3].

• HY-P1068B

  Lysozyme, Human Neutrophil	Inhibitor
  Lysozyme, Human Neutrophil is found to be present in all three types of human neutrophil granules (azurophil-, specific- and gelatinase granules). Lysozyme, Human Neutrophil takes part in antibacterial activity of leukocytes[1].

• HY-108971R

  Demecycline (Standard)	Inhibitor
  Uridine 5'-monophosphate (disodium salt) (Standard) is the analytical standard of Uridine 5'-monophosphate (disodium salt). This product is intended for research and analytical applications. Uridine 5'-monophosphate disodium salt is component used for RNA synthesis.

• HY-17357R

  Nepafenac (Standard)
  Nepafenac (Standard) is the analytical standard of Nepafenac. This product is intended for research and analytical applications. Nepafenac (AHR 9434; AL 6515; Nevanac) is a COX-2 inhibitor and the original drug of Amfenac.

• HY-B0593A

  Ceftazidime pentahydrate	Inhibitor	99.87%
  Ceftazidime (GR20263) pentahydrate , an antibiotic, has a broad spectrum activity against Gram-positive and Gram-negative aerobic bacteria. Ceftazidime pentahydrate is also active against Enterobacteriaceae (including β-lactamase-positive strains) and is resistant to hydrolysis by most β-lactamases[1].

• HY-137407

  N-Phenylacetyl-L-homoserine lactone	Inhibitor	99.60%
  N-Phenylacetyl-L-homoserine lactone is a small diffusible signaling molecule that strongly antagonizes or super-activates the quorum sensing of Vibrio fischeri[1].

• HY-121310

  Phthalocyanine	Inhibitor
  Phthalocyanine is a photosensitizer. Phthalocyanine has a light-killing effect on bacterial biofilms, effectively inactivating bacteria. Phthalocyanine can be linked to anticancer drugs to target cancer. Phthalocyanine can also be used to develop chemical sensors for studying microbial infections and tumors[1][2].

• HY-157046

  ATP Synthesis-IN-2	Inhibitor
  ATP Synthesis-IN-2 (Compound 5) is an antibacterial compound. ATP Synthesis-IN-2 is a potent ATP synthesis activity inhibitor with IC50 against Pseudomonas aeruginosa (PA) Value of 0.7 μg/mL[1].

• HY-N13869

  Asperlin	Inhibitor
  Asperlin is an orally active marine-derived antibiotic with antifungal, anticancer, anti-inflammatory and anti-atherosclerotic activities. Asperlin induces apoptosis. Asperlin increases reactive oxygen species (ROS)- and DNA damage-associated G2/M phase arrest and ATM phosphorylation. Asperlin is effective in preventing HFD-induced obesity and modulating gut microbiota[1][2][3][4][5].

• HY-B1175R

  (2S,5R,6R)-Ticarcillin (disodium) (Standard)	Inhibitor
  (2S,5R,6R)-Ticarcillin (disodium) (Standard) is the analytical standard of (2S,5R,6R)-Ticarcillin (disodium). This product is intended for research and analytical applications. (2S,5R,6R)-Ticarcillin disodium is an injectable antibiotic for the treatment of Gram-negative bacteria, particularly Pseudomonas aeruginosa. It is also one of the few antibiotics capable of treating Stenotrophomonas maltophilia infections.

• HY-B0328R

  Triamcinolone (Standard)		98.42%
  Triamcinolone (Standard) is the analytical standard of Triamcinolone. This product is intended for research and analytical applications.

• HY-W716673

  Ftivazide	Inhibitor
  Ftivazide has anti-tuberculosis activity[1].

• HY-17566R

  Capreomycin (sulfate) (Standard)	Inhibitor
  Capreomycin (sulfate) (Standard) is the analytical standard of Capreomycin (sulfate). This product is intended for research and analytical applications. Capreomycin sulfate is a macrocyclic peptide antibiotic that inhibits phenylalanine synthesis in mycobacterial ribosomal translation. Capreomycin sulfate has anti-amyloidogenic and pro-fibrinolytic activities, reducing amyloid-induced cytotoxicity by inhibiting the occurrence of amyloid fibrillation. Capreomycin sulfate can be used in the study of multidrug-resistant tuberculosis, type 2 diabetes, Alzheimer's disease and Parkinson's disease[1][2][3][4][5].

• HY-100262

  Sulfasymazine	Inhibitor
  Sulfasymazine is a sulfonamide agent and displays antibacterial properties.

• HY-W010520

  Methylisothiazolinone	Inhibitor	99.37%
  Methylothiazolinone is a bacterial and fungal inhibitor and preservative, as well as a sensitizer. Methylisothiazolinone can activate matrix metalloproteinases (MMPs) in human bronchial epithelial cells to induce apoptosis and inflammatory response. Methylisothiazolinone can promote the development of atopic dermatitis in mice by disrupting Th2/Th17 related immune responses. Methylisothiazolinone can cause mitochondrial damage in the endothelium of rat cerebral blood vessels[1][2][4].

• HY-P5601

  Thanatin	Inhibitor
  Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption[1][2].

• HY-17408

  Mevastatin	Inhibitor	99.46%
  Mevastatin (Compactin) is a first HMG-CoA reductase inhibitor that belongs to the statins class. Mevastatin is a lipid-lowering agent, and induces apoptosis, arrests cancer cells in G0/G1 phase. Mevastatin also increases endothelial nitric oxide synthase (eNOS) mRNA and protein levels. Mevastatin has antitumor activity and has the potential for cardiovascular diseases treatment[1][2][3].

• HY-W015786R

  4-Ethoxyphenol (Standard)	Inhibitor
  L-Amoxicillin (Standard) is the analytical standard of L-Amoxicillin. This product is intended for research and analytical applications. L-Amoxicillin is an antibiotic with activity against a wide range of bacterial infections. L-Amoxicillin is commonly used in antibacterial combinations when used in combination with the β-lactamase inhibitor potassium clavulanic acid. The related substances analysis method for L-Amoxicillin has been developed and validated according to the International Conference on Harmonization (ICH) guidelines, ensuring its effectiveness and accuracy in mixtures. L-Amoxicillin and some of its impurities have been further analyzed in stress testing and stability studies, providing support for optimizing its application[1].

• HY-N7071A

  Maduramicin ammonium	Inhibitor
  Maduramicin (Maduramycin) ammonium is isolated from the actinomycete Actinomadura rubra. Maduramicin ammonium is an oral active anticoccidial agent used in research related to Eimeria, Adenosarcina, Enterococcus faecalis, and Enterococcus disperitus infections. Maduramicin ammonium induces apoptosis (apoptosis) in chicken cardiomyocytes through both intrinsic and extrinsic pathways and also impairs autophagic flux and induces rhabdomyolysis by activating the AMPK-mediated eIF2α-ATF4 endoplasmic reticulum stress pathway[1][2][3][4].

• HY-161404

  Antibacterial agent 202	Inhibitor
  Antibacterial agent 202 (compound 45c) is a low cytotoxicity bacterial inhibitor with good activity against Gram-negative bacteria, including Escherichia coli, Klebsiella pneumonia, especially Pseudomonas aeruginosa, (MIC (minimum inhibitory concentration)=7.8-31.25 μM). Antibacterial agent 202 can exert antibacterial activity by destroying the integrity of cell membranes and can be used in the research of bacterial infections[1].

• HY-W074648

  Antibacterial agent 18	Inhibitor
  Antibacterial agent 18 is a multi-arm AIE molecule extracted from patent CN110123801A, compound 23. Antibacterial agent 18 can be used for resisting Gram-positive and Gram-negative bacteria. Antibacterial agent 18 can be conjugated in the cell wall of rigid arm configuration insertion bacterium, and block cell wall turns sugar and turns peptide process, to inhibit or kill bacterium[1].

• HY-144427S

  Vitamin E-13C2,d6	Inhibitor
  Vitamin E-13C2,d6 is a 13C-labeled and deuterium labeled Vitamin E[1].

• HY-145439

  Colistin adjuvant-1	Inhibitor
  Colistin adjuvant-1 is a colistin adjuvant, shows increased colistin potentiation activity against Gram-negative bacteria. Colistin adjuvant-1 inhibits NF-κB with an IC50 of 0.209 μM[1].

• HY-Y0682R

  Ethylenediaminetetraacetic acid (Standard)	Inhibitor
  Ethylenediaminetetraacetic acid (Standard) is the analytical standard of Ethylenediaminetetraacetic acid. This product is intended for research and analytical applications. Ethylenediaminetetraacetic acid (EDTA) is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-152090

  Antiproliferative agent-17	Inhibitor
  Antiproliferative agent-17 is an antiproliferative agent. Antiproliferative agent-17 inhibits Gram-positive bacteria and has anticancer activity[1].

• HY-N10986

  (±)-Hydnocarpin
  (±)-Hydnocarpin is a flavonolignan. (±)-Hydnocarpin can inhibit the growth of S. aureus with a MIC50 value of 3.1 μM[1].

• HY-P5608

  Maximin 4	Inhibitor
  Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 4 has cytotoxicity on tumor cells and spermicidal effect[1].

• HY-162853

  Mtb-IN-8	Inhibitor
  Mtb-IN-8 (compound 5jb) is an orally active inhibitor of Mycobacterium tuberculosis (Mtb) with MIC values of 0.03 μg/mL for H37Rv and 0.125-0.06 μg/mL for MDR-Mtb, respectively[1].

• HY-B0334

  Sulbactam	Inhibitor	99.75%
  Sulbactam (CP45899) is a competitive, irreversible beta-lactamase inhibitor. Sulbactam shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus--Acinetobacter baumannii (Acb) complex[1][2].

• HY-108880

  Carindacillin sodium	Inhibitor
  Carindacillin (Carbenicillin indanyl) sodium is an orally active and broad-spectrum antimicrobial agent. Carindacillin sodium can be hydrolyzed to Carbenicillin in vivo. Carindacillin sodium can be used for the research of urinary-tract infection[1][2].

• HY-103095A

  Enmetazobactam iodide
  Enmetazobactam (iodide) (AAI101 (iodide)) is an extended-spectrum β-lactamase inhibitor, against many resistant Gram-negative pathogens[1][2].

• HY-B1207S

  Urethane-d5	Inhibitor	98.2%
  Urethane-d5 is the deuterium labeled Urethane. Urethane (Ethyl carbamate), the ethyl ester of carbamic acid, is a byproduct of fermentation found in various food products. Urethane has the ability to suppress bacterial, protozoal, sea urchin egg, and plant tissue growth in vitro[1].

• HY-148568

  TMV-IN-2
  TMV-IN-2, chalcone derivative, is a tobacco mosaic virus (TMV) inhibitor. TMV-IN-2 has antiviral activity against TMV with an EC50 value of 89.9 μg/mL. TMV-IN-2 can be used for the research of infection, inflammation and tumor[1].

• HY-B1894

  Cefetamet pivoxyl	Inhibitor
  Cefetamet pivoxyl is a cephalosporin antibiotic. Cefetamet pivoxyl inhibits 355 enteropathogens Keime, Gram-negative bacteria (ausgenommen Pseudomonas aeruginosa) and Legionella pneumophila[1].

• HY-148209

  Balhimycin	Inhibitor
  Balhimycin is a glycopeptide antibiotic, found from the fermentation broth of a Amycolatopsis sp. Balhimycin shows anti-bacterial activity against staphylococci and anaerobes[1].

• HY-P2317

  Cecropin P1, porcine	Inhibitor	99.83%
  Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection[1][2].

• HY-A0110AR

  Cefotiam hexetil (hydrochloride) (Standard)	Inhibitor

• HY-N7252R

  Daphnin (Standard)	Inhibitor
  Daphnin (Standard) is the analytical standard of Daphnin. This product is intended for research and analytical applications. Daphnin is one of the major coumarin bioactive components with antibacterial activity. Daphnin is isolated from the whole herb of Daphne odora (Thunb.), which is a folk medicine in China for the relief of fever[1][2].

• HY-101412

  2-(Methylamino)-1H-purin-6(7H)-one
  2-(Methylamino)-1H-purin-6(7H)-one (N2-Methylguanine) is a modified nucleoside. 2-(Methylamino)-1H-purin-6(7H)-one is an endogenous methylated nucleoside found in human fluids.

• HY-139645

  MtDTBS-IN-1	Inhibitor
  MtDTBS-IN-1 is a particularly potent binder (KD = 57 nM) and inhibitor (Ki = 5 μM) of MtDTBS.

• HY-118773

  MreB Perturbing Compound A22 hydrochloride	Inhibitor
  MreB Perturbing Compound A22 hydrochloride is a benzylisothiourea compound that interacts with the ATP binding site of MreB rapidly and reversibly. MreB Perturbing Compound A22 hydrochloride blocks normal rod shape formation and inhibits chromosome partitioning in E. coli, inhibiting growth (MIC=3.1 µg/ml).

• HY-117492

  Aconiazide	Inhibitor
  Aconiazide (Isonicophen) is a orally active hydrazone derivative of isoniazid, and can be used for study of tuberculosis[1].

• HY-139766

  Antibacterial agent 49	Inhibitor
  Antibacterial agent 49 (example 12) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-121329

  Carumonam	Inhibitor
  Carumonam (AMA-1080; Ro 17-2301) is a sulfonated monocyclic β-Lactam Antibiotic, targeting to penicillin-binding protein (PBP). Carumonam exerts highly activity against Enterobacteriaceae, Pseudomonas aeruginosa, and Haemophilus influenzae, while it weakly and even inactively inhibits Streptococcus pneumoniae and Staphylococcus aureus. Carumonam is resistant to beta-lactamase-mediated hydrolysis[1].

• HY-139757

  Antibacterial agent 40
  Antibacterial agent 40 is an antibacterial agent (extracted from patent WO2015159265A1, compound C) [1].

• HY-103249

  Reutericyclin	Inhibitor	98.11%
  Reutericyclin (Reutericycline), a unique tetramic acid, is an antibiotic produced by some strains of Lactobacillus reuteri. Reutericyclin (Reutericycline) exhibits a broad inhibitory spectrum including Lactobacillus spp., Bacillus subtilis, B. cereus, Enterococcus faecalis, Staphylococcus aureus, and Listeria innocua[1][2].

• HY-B0986

  Hexylresorcinol	Inhibitor	99.52%
  Hexylresorcinol (4-Hexylresorcinol) is a natural compound found in plants with antimicrobial, anthelmintic, antiseptic and antitumor activities. Hexylresorcinol can induce apoptosis in squamous carcinoma cells. Hexylresorcinol is a reversible and noncompetitive inhibitor of α-glucosidase. Hexylresorcinol has protective effects against oxidative DNA damage[1][2][3][4][5].

• HY-P990021

  Calpurbatug
  Calpurbatug is an immunoglobulin G1 antibody. Calpurbatug has activity with anti-bacterial DNA-binding protein DNABII family and anti-human monoclonal TRL1068 γ1-chain[1].

• HY-119686

  Miloxacin	Inhibitor
  Miloxacin is an orally active bacteriostatic agent targeting Gram-negative bacteria, exhibiting antibacterial properties similar to Oxolinic acid (HY-B1002) and Nalidixic acid (HY-B0398)[1].

• HY-B0905R

  Tilmicosin (Standard)	Inhibitor
  Tilmicosin (Standard) is the analytical standard of Tilmicosin. This product is intended for research and analytical applications. Tilmicosin (LY-177370) is an orally active calcium channel antagonist and macrolide antibiotic with antimicrobial activity. Tilmicosin mainly acts on the 50S subunit of bacterial ribosomes, inhibiting protein synthesis. Tilmicosin is effective in the treatment of respiratory diseases in livestock such as cattle, sheep and pigs. In addition, Tilmicosin has immunomodulatory and anti-inflammatory effects[1].

• HY-B1190R

  Cefadroxil (Standard)	Inhibitor	98.85%
  Cefadroxil (Standard) is the analytical standard of Cefadroxil. This product is intended for research and analytical applications. 0

• HY-149998

  Antimycobacterial agent-5	Inhibitor
  Antimycobacterial agent-5 (compound 27) is an imidazopyridine amide targeting mycobacterial electron transport chain (ETC) airway CIII2CIV2 supercomplexes. The IC50 value of Antimycobacterial agent-5 against Mycobacterium smegmatisCIII2CIV2 is 441 nM[1].

• HY-N7123S

  Sulfacetamide-d4	Inhibitor
  Sulfacetamide-d4 is the deuterium labeled Sulfacetamide. Sulfacetamide (Sulphacetamide), a bacteriostatic sulphonamide, is a popular antibiotic prescribed for treating ocular infections[1][2].

• HY-108402

  Cefodizime	Inhibitor
  Cefodizime is a third generation cephalosporin antibiotic with a broad spectrum of antibacterial activity. Cefodizime has no renal toxic effect, good tolerance and immune regulation activity, and has the potential for severe infections of the respiratory and urinary tracts[1][2].

• HY-144767

  PA3552-IN-1	Inhibitor	98.55%
  PA3552-IN-1 (compound 15) is an antibiotic adjuvant that restores sensitivity of MDR P. aeruginosa DK2 strain to Polymyxin B. PA3552-IN-1 can reduce PA3552 expression[1].

• HY-B0268AR

  Enoxacin (hydrate) (Standard)	Inhibitor
  Enoxacin (hydrate) (Standard) is the analytical standard of Enoxacin (hydrate). This product is intended for research and analytical applications. Enoxacin hydrate (Enoxacin sesquihydrate), a fluoroquinolone, interferes with DNA replication and inhibits bacterial DNA gyrase (IC50=126 μg/ml) and topoisomerase IV (IC50=26.5 μg/ml). Enoxacin hydrate is a miRNA processing activator and enhances siRNA-mediated mRNA degradation and promotes the biogenesis of endogenous miRNAs. Enoxacin hydrate has potent activities against gram-positive and -negative bacteria. Enoxacin hydrate is a cancer-specific growth inhibitor that acts by enhancing TAR RNA-binding protein 2 (TRBP)-mediated microRNA processing[1][2][3][4].

• HY-139618R

  Dup-721 (Standard)	Inhibitor
  Celiprolol (hydrochloride) (Standard) is the analytical standard of Celiprolol (hydrochloride). This product is intended for research and analytical applications. Celiprolol (REV 5320) is a potent, cardioselective and orally active β1-andrenoceptor r antagonist with partial β2 agonist activity, with Ki values of 0.14-8.3 μM. Celiprolol has antihypertensive and antianginal activity, and can be used for the research of cardiovascular disease such as high blood pressure[1][4].

• HY-W713855

  (4-Aminobenzoyl)-D-glutamic acid	Inhibitor
  (4-Aminobenzoyl)-D-glutamic acid (Compound 17) exhibits competitive inhibitory activity against H2-pteroate synthesis system, which affects the synthesis of folate, thereby inhibiting growth of bacteria[1].

• HY-N14051

  Arizonin C1	Inhibitor
  Arizonin C1 is a microbial metabolite with anti-Gram-positive bacterial activities[1].

• HY-157987

  MBX3135
  MBX3135 is an efflux pump inhibitor which can enhance the effect of antibiotics through the AcrB target of bacteria. MBX3135 can be used for research of infection and antibiotics[1].

• HY-116282P

  Dextran sulfate, high sulfate (MW 5000)
  Dextran sulfate, high sulfate (MW 5000), a biopolymer, is a sulfated polysaccharide. Dextran sulfate, high sulfate (MW 5000) has antiviral, antibacterial, anti-inflammatory, antifibrotic, and wound-healing properties. Dextran sulfate can be used as an additive in cell culture media for preventing cell aggregation and in cosmetics as a gel-forming agent[1].

• HY-106572A

  Cefbuperazone sodium
  Cefbuperazone sodium is an antibacterial agent that demonstrates significant activity against bacterial infections. Cefbuperazone sodium exhibits a linear pharmacokinetic profile, allowing for effective dosage determination in clinical settings. Cefbuperazone sodium reaches peak concentrations in human plasma following intravenous infusion, indicating its rapid absorption and distribution. Cefbuperazone sodium is primarily excreted unchanged in urine, highlighting its efficiency in renal elimination.

• HY-147546

  Antibacterial agent 107	Inhibitor
  Antibacterial agent 107 (compound 14) is a potent antibacterial agent. Antibacterial agent 107 shows potent antibacterial activity against Gram-positive bacteria, with a MIC of 1.56 μg/mL (MRSA). Antibacterial agent 107 exhibits low hemolytic activity, high membrane selectivity, and rapid bactericidal activity. Antibacterial agent 107 shows effective in vivo efficacy in the murine model of bacterial keratitis caused by Staphylococcus aureus ATCC29213[1].

• HY-P10913

  HYNIC-UBI29-41
  HYNIC-UBI29-41 is composed of a bifunctional chelator HYNIC and an antimicrobial peptide UBI 29-41. HYNIC-UBI29-41 retains the antibacterial properties of UBI 29-41, and exhibits good affinity to Gram-positive and Gram-negative bacteria. HYNIC-UBI29-41 can be used as an imaging agent for bacterial infection detection in mouse models, when labeled with the radioactive element technetium (99mTc)[1].

• HY-P10857

  Microcin J25	Inhibitor
  Microcin J25 (MccJ25) is a cyclic peptide antibiotic consisting of 21 unmodified amino acid residues. Microcin J25 inhibits DNA-dependent RNA polymerase (RNAP) of Gram-negative bacteria. Microcin J25 has antibacterial activity[1][2].

• HY-109000

  Afabicin	Inhibitor	98.02%
  Afabicin (Debio 1450) is the proagent of Debio1452, specifically targeting staphylococci without significant activity against other Gram-positive or Gram-negative species. Debio1452 is an inhibitor FabI, an enzyme critical to fatty acid biosynthesis in staphylococci.

• HY-B1213AR

  Trimipramine (Standard)	Inhibitor
  Trimipramine (Standard) is the analytical standard of Trimipramine. This product is intended for research and analytical applications. Trimipramine is a 5-HT receptor antagonist, with pKi binding values of 6.39, 8.10, 4.66 for 5-HT1C, 5-HT2 and 5-HT1A, respectively. Trimipramine is also a potent and selective inhibitor targeting human noradrenaline (hNAT), serotonin (hSERT) and organic cation transporters (hOCT1, hOCT2) with IC50 values of 4.99 μM, 2.11 μM, 3.72 μM, 8.00 μM, respectively. Trimipramine has vascular activity and anxiolytic efficacy[1][2][3].

• HY-B0337R

  Sulfadimethoxine (Standard)	Inhibitor
  Sulfadimethoxine (Standard) is the analytical standard of Sulfadimethoxine. This product is intended for research and analytical applications. Sulfadimethoxine (Sulphadimethoxine) is a sulfonamide antibiotic used to treat many infections[1][2].

• HY-B0268A

  Enoxacin hydrate	Inhibitor	99.85%
  Enoxacin hydrate (Enoxacin sesquihydrate), a fluoroquinolone, interferes with DNA replication and inhibits bacterial DNA gyrase (IC50=126 μg/ml) and topoisomerase IV (IC50=26.5 μg/ml). Enoxacin hydrate is a miRNA processing activator and enhances siRNA-mediated mRNA degradation and promotes the biogenesis of endogenous miRNAs. Enoxacin hydrate has potent activities against gram-positive and -negative bacteria. Enoxacin hydrate is a cancer-specific growth inhibitor that acts by enhancing TAR RNA-binding protein 2 (TRBP)-mediated microRNA processing[1][2][3][4].

• HY-10581A

  Gatifloxacin hydrochloride	Inhibitor	99.94%
  Gatifloxacin hydrochloride (AM-1155; BMS-206584; PD135432) is a potent fluoroquinolone antibiotic with broad-spectrum antibacterial activity. Gatifloxacin hydrochloride inhibits bacterial type II topoisomerases (IC50=13.8 μg/ml for S. aureus topoisomerase IV) and E. coli DNA gyrase (IC50 = 0.109 μg/ml)[1]. Gatifloxacin hydrochloride can be used to treat bacterial conjunctivitis in vivo.

• HY-161148

  FtsZ-IN-9	Inhibitor
  FtsZ-IN-9 (compound 11) is an antimicrobial agent. FtsZ-IN-9 inhibits the assembly of Mycobacterium smegmatis FtsZ (MsFtsZ)[1].

• HY-146051

  Antitubercular agent-18	Inhibitor
  Antitubercular agent-18 (Compound 9a) is an antitubercular agent with MIC values of 2, 2, 2 and 128 µg/ml against M. tuberculosis H37Rv, Spec. 192, Spec 210 and Spec. 800, respectively. Antitubercular agent-18 shows highly selective antimycobacterial effects[1].

• HY-N1887

  4-Allylcatechol	Inhibitor	99.73%
  4-Allylcatechol (4-Allylpyrocatechol) is a xylan which has oral activity and can be isolated from the root of Piper taiwanense. 4-Allylcatechol has a strong inhibitory activity against collagen-induced platelet aggregation (IC50 = 5.3 μM). In addition, 4-Allylcatechol has anti-tuberculosis activity against Mycobacterium tuberculosis H37Rv (MIC = 27.6 μg/mL)[1].

• HY-N10271

  SCH 38519	Inhibitor
  SCH 38519 is a platelet aggregation inhibitor. SCH 38519 inhibits thrombin-induced aggregation of human platelets with an IC50 of 68 μg/mL. SCH 38519 is also active against Gram-positive and Gram-negative bacteria [1].

• HY-121290

  BPH-651	Inhibitor
  BPH-651 is a compound with antibacterial activity and has the activity to inhibit dehydrosqualene synthase. BPH-651 can bind to different sites of dehydrosqualene synthase, providing structural clues for the mechanism and inhibition of head-to-head prenyltransferase, which will help future compound design.

• HY-P5644

  Retrocyclin-3
  Retrocyclin-3 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus[1].

• HY-129580

  Nannochelin B	Inhibitor
  Nannochelin B is a novel citrate-hydroxamate siderophore with a growth-inhibitory activity against some bacteria and fungi[1].

• HY-113471A

  (S)-(-)-Perillic acid	Inhibitor
  (S)-(-)-Perillic acid is a terpenoid plant extract with antimicrobial and anticancer activities. (S)-(-)-Perillic acid induces cell apoptosis and cell cycle arrest, and increases the levell of Bax, Bcl2, p21 and caspase-3 proteins. (S)-(-)-Perillic acid can be used for cancer and infection research[1][2][3].

• HY-155011

  MB076	Inhibitor
  MB076 is a novel heterocyclic triazole with improved plasma stability. MB076 inhibits seven different Class C Acinetobacter-derived cephalosporinases (ADCs) β-lactamase variants with Ki values ＜ 1 μM. MB076 acts synergistically in combination with multiple cephalosporins to restore pBCSK(−) susceptibility[1].

• HY-A0178S

  Isothipendyl-d6	Inhibitor
  Isothipendyl-d6 is the deuterium labeled (7E,9E)-β-Ionylideneacetaldehyde[1].

• HY-P5715

  Im6	Inhibitor
  Im6 is an antimicrobial peptide. Im6 is active against S. aureus and B.subtilis (Gram-positive bacterial)[1].

• HY-14648S3

  Dexamethasone-4,6α,21,21-d4	Inhibitor
  Dexamethasone-4,6α,21,21-d4 is the deuterium labeled Dexamethasone-4,6α,21,21. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

• HY-120747

  A-65282	Inhibitor
  A-65282 is an antibacterial agent. A-65282 inhibits P4 DNA unknotting with an IC50 value of 8 µg/mL. A 65281 induces DNA breakage mediated by calf thymus topoisomerase II[1].

• HY-B0923R

  Danthron (Standard)	Inhibitor
  Danthron (Standard) is the analytical standard of Danthron. This product is intended for research and analytical applications. Danthron is a natural product extracted from the traditional Chinese medicine Salvia miltiorrhiza Bunge. Danthron functions in regulating glucose and lipid metabolism by activating AMPK.

• HY-B0364AR

  Dyclonine (hydrochloride) (Standard)	Inhibitor
  Dyclonine (hydrochloride) (Standard) is the analytical standard of Dyclonine (hydrochloride). This product is intended for research and analytical applications. Dyclonine (Dyclocaine) hydrochloride is an orally effective ALDH covalent inhibitor (crosses blood-brain barrier), with an IC50 of 35 μM for ALDH2 and 76 μM for ALDH3A1. Dyclonine hydrochloride has sensitizing activities for targeted cancer cells and antibacterial. Dyclonine hydrochloride is also a local agent that can suppress or relieve pain. that blocks the transmission of various nerve impulses or stimuli and inhibits the sensation of touch and pain[1][2][3].

• HY-139834

  Antistaphylococcal agent 1	Inhibitor
  Antistaphylococcal agent 1 is an antistaphylococcal therapeutic agent.

• HY-122490

  Laidlomycin	Inhibitor
  Lincomycin (compound II) is a new polyether antibiotic that can be isolated from streptoverticillium olivoreticuli[1].

• HY-B1355AS1

  Oxyphenbutazone-13C6	Inhibitor
  Oxyphenbutazone-13C6 is the 13C6 labeled Oxyphenbutazone (HY-B1355A). Oxyphenbutazone is a phenylbutazone derivative, with anti-inflammatory effect. Oxyphenbutazone is a non-selective COX inhibitor. Oxyphenbutazone is the metabolite of Phenylbutazone (HY-B0230). Oxyphenbutazone selectively kills non-replicating Mycobaterium tuberculosis[1][2].

• HY-142127

  Ribostamycin
  Ribostamycin (Vistamycin) is a broad-spectrum aminoglycoside antibiotic. Ribostamycin is effective against Gram-Negative and Gram-Positive bacterial infection. Ribostamycin also inhibits the chaperone activity of PDI[1][2].

• HY-121144R

  Cefazedone (Standard)	Inhibitor
  Cefazedone (Standard) is the analytical standard of Cefazedone. This product is intended for research and analytical applications. Cefazedone (Refosporen), a first-generation cephalosporin, is a time-dependent antibiotic with activity against Gram-positive and Gram-negative bacteria[1].

• HY-151553

  Mtb-cyt-bd oxidase-IN-6	Inhibitor
  Mtb-cyt-bd oxidase-IN-6 is a potent Mycobacterium tuberculosis (Mtb) cytochrome bd (cyt-bd) oxidase (MtbCyt-bd Oxidase) inhibitor with an IC50 value of 0.35 μM. Mtb-cyt-bd oxidase-IN-6 can effectively inhibit the growth of Mtb (MIC= 4 μM). Mtb-cyt-bd oxidase-IN-6 can be used in the study of tuberculosis[1].

• HY-146062

  Antibacterial agent 101	Inhibitor
  Antibacterial agent 101 (Compd 7f) is an antimicrobial (antibacterial and antifungal) agent, with MIC values between 4 and 32 µg/mL[1].

• HY-101411R

  4-Acetamidobutanoic acid (Standard)	Inhibitor
  Josamycin propionate (Standard) is the analytical standard of Josamycin propionate. This product is intended for research and analytical applications. Josamycin propionate is classified as a macrolide antibiotic.

• HY-100622

  Ro 20-0657/000	Inhibitor
  Ro 20-0657/000 is a metabolite of Trimethoprim. Trimethoprim is a dihydrofolate reductase inhibitor, used as an antibacterial agent in human and veterinary medicine[1][2][3].

• HY-16908AR

  Lefamulin (acetate) (Standard)	Inhibitor

• HY-N0804R

  Narirutin (Standard)	Inhibitor
  Narirutin (Standard) is the analytical standard of Narirutin. This product is intended for research and analytical applications. Narirutin, one of the active constituents isolated from citrus fruits, has antioxidant and anti-inflammatory activities. Narirutin is a shikimate kinase inhibitor with anti-tubercular potency[1][2].

• HY-N11422

  Mycaminosyltylonolide	Inhibitor
  Mycaminosyltylonolide is a potent antibiotic. Mycaminosyltylonolide shows antibacterial activity. Mycaminosyltylonolide inhibits luciferase synthesis[1][2].

• HY-N6931

  Usaramine	Inhibitor	99.57%
  Usaramine is a pyrrolizidine alkaloid isolated from seeds of Crolatalaria pallida. Usaramine demonstrates a highlighted antibiofilm activity against Staphylococcus epidermidis by reducing more than 50% of biofilm formation without killing the bacteria[1].

• HY-114860

  LY 215891	Inhibitor
  LY 215891 (compound 6a) exhibits potent Gram-positive and Gram-negative antibacterial activity with MICs of 0.015 μg/mL and 0.06 μg/mL for Klebsiella pneumoniae X26 and Escherichia coli EC14, respectively[1].

• HY-159628A

  Glu-AMS TEA
  Glu-AMS TEA is a competitive inhibitor of Escherichia coli glutamyl-tRNA synthetase (GluRS), with the Ki of 2.8 nM[1].

• HY-W016491

  Isopropyl 4-hydroxybenzoate	Inhibitor
  Isopropyl 4-hydroxybenzoate (Isopropylparaben) is an antimicrobial and antioxidant agent[1].

• HY-143408

  OYYF-175	Inhibitor
  OYYF-175, an antimicrobial antifolate, is a dihydrofolate reductase (DHFR) inhibitor with an IC50 of 2.36 nM for Escherichia coli DHFR. OYYF-175 exhibits potent broad-spectrum antibacterial activities, especially against multi-drug resistant Gram-Negative-strains[1].

• HY-B1340

  Carbadox	Inhibitor
  Carbadox is a quinoxaline-di-N-oxide antibiotic compound which is widely fed to nursery-age pigs to control enteric diseases and improve feed efficiency.

• HY-158190

  Rose Bengal Chloramphenicol Agar	Inhibitor
  Rose-Bengal Chloramphenicol Agar is a selective medium for the enumeration of yeasts and moulds from a wide variety of foodstuffs. The medium has a neutral pH and chloramphenicol is used as a selective agent to suppress the growth of bacteria[1].

• HY-168626A

  Antibacterial agent 252 hydrochloride	Inhibitor
  Antibacterial agent 252 hydrochloride is an amino acid derivative with antibacterial activity. Antibacterial agent 252 hydrochloride enhances the killing of colistin sulfate (HY-A0089) against a variety of gram-negative bacteria by targeting the bacterial membrane[1].

• HY-B0934R

  Ethylparaben (Standard)	Inhibitor
  Ethylparaben (Standard) is the analytical standard of Ethylparaben. This product is intended for research and analytical applications. Ethylparaben is the ethyl ester of paraben and is used as an antifungal preservative and food additive[1][2].

• HY-N14256

  Amycin B	Inhibitor
  Amycin B, a natural Niphimycin analog, is active against Gram-positive bacteria and fungi[1].

• HY-133056R

  Pseudomonic acid C (Standard)	Inhibitor
  Algestone acetophenide (Standard) is the analytical standard of Algestone acetophenide. This product is intended for research and analytical applications. Algestone acetophenide is a progesterone drug. Algestone acetophenide can be used in combination with estrogen as a long-acting injectable contraceptive[1].

• HY-17516

  Tolfenpyrad	Inhibitor	98.64%
  Tolfenpyrad is an insecticide approved for marketing in Japan in 2002.

• HY-134274

  8-Br-GTP	Inhibitor
  8-Br-GTP, a GTP analog, is a competitive FtsZ polymerization and GTPase activity (Ki of 31.8 μM) inhibitor. 8-Br-GTP can be used for nucleic acid modification[1].

• HY-B0356B

  Ciprofloxacin hydrochloride monohydrate	Inhibitor	99.90%
  Ciprofloxacin (Bay-09867) hydrochloride monohydrate is a potent, orally active topoisomerase IV inhibitor. Ciprofloxacin hydrochloride monohydrate induces mitochondrial DNA and nuclear DNA damage and lead to mitochondrial dysfunction, ROS production. Ciprofloxacin hydrochloride monohydrate has anti-proliferative activity and induces apoptosis. Ciprofloxacin hydrochloride monohydrate is a fluoroquinolone antibiotic, exhibiting potent antibacterial activity[1][2][3][4].

• HY-118281

  ATD-3169	Inhibitor
  ATD-3169 is an antibacterial agent. ATD-3169 enhances endogenous ROS, including superoxide radicals, to inhibit Mycobacterium tuberculosis (Mtb)[1].

• HY-114318

  Bz-DL-Arg-βNA hydrochloride
  Bz-DL-Arg-βNA hydrochloride is a substrate for endopeptidases but is not hydrolyzed by bacterial dipeptidyl peptidase DPP-III[1].

• HY-151401

  Antimicrobial agent-7	Inhibitor
  Antimicrobial agent-7 (Compound 12) is a potent antimicrobial agent, and shows potent antimicrobial activity with an MIC range of 2-8 μg/mL against Gram-negative and Gram-positive bacteria. Antimicrobial agent-7 shows anti-inflammatory activity against lipopolysaccharide-induced inflammation[1].

• HY-17466R

  Sancycline (Standard)	Inhibitor

• HY-N2443

  Tribuloside	Inhibitor	99.64%
  Tribuloside is a flavonoid that can be isolated from Tribulus terrestris L[1]. Tribuloside exhibits anti-mycobacterial activity against the non-pathogenic Mycobacterium species with a minimum inhibitory concentration (MIC) of 5.0 mg/mL. Tribuloside has 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity[2].

• HY-P5648

  PhD2	Inhibitor
  PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans[1].

• HY-B1190

  Cefadroxil	Inhibitor
  Cefadroxil is a broad-spectrum antibiotic of the cephalosporin type, effective in Gram-positive and Gram-negative bacterial infections.

• HY-P5609

  Maximin 5	Inhibitor
  Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 5 has cytotoxicity on tumor cells and spermicidal effect[1].

• HY-B0554R

  Norethindrone (Standard)		99.01%
  Norethindrone (Standard) is the analytical standard of Norethindrone. This product is intended for research and analytical applications. Norethindrone is a female progestin approved by FDA for the treatment of endometriosis, uterine bleeding caused by abnormal hormone levels, and secondary amenorrhea.

• HY-155201

  YJ182	Inhibitor
  YJ182 is a NDM-1 inhibitor (IC50: 0.23 μM). YJ182 also inhibits IMP-1, VIM-2, GIM-1, and MMP-2, with IC50s of 0.25, 0.61, 0.49, and 6.92 μM respectively. YJ182 can be used for bacterial infection research[1].

• HY-B0456

  Riboflavin		99.89%
  Riboflavin, an orally active and easily absorbed micronutrient, is a precursor of flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), which serve as coenzymes for numerous enzymatic reactions and perform key metabolic functions by mediating the transfer of electrons in biological oxidation-reduction reaction[1].

• HY-B0991S

  Amoxapine-d8	Inhibitor
  Amoxapine-d8 is the deuterium labeled Amoxapine. Amoxapine (CL-67772) is a norepinephrine reuptake blocker and a 5-HT2/5-HT3 antagonist. Amoxapine can be used for the research of depression. Amoxapine has antibacterial activity. Amoxapine can enhance the killing effect of macrophages on mycobacterium by inducing autophagy, while protecting the cells from death[1][2][3][4].

• HY-139805

  Ticarcillin	Inhibitor
  Ticarcillin is a semisynthetic, extended-spectrum, carboxypenicillin antibacterial agent, and is active against gram-positive cocci, including streptococci and staphylococci. Ticarcillin is also effective against most gram-negative organisms, including Pseudomonas aeruginosa. Ticarcillin can be used in lower respiratory tract infections, skin and skin structure infections, urinary tract infections, and intraabdominal infections research[1][2][3].

• HY-W010608R

  2-Methyltetrahydrofuran-3-one (Standard)

• HY-130339

  Teicoplanin A2-4	Inhibitor
  Teicoplanin A2-4 is an antibiotic active against Gram-positive aerobic and anaerobic bacteria[1].

• HY-B0329R

  Isoniazid (Standard)	Inhibitor
  Isoniazid (Standard) is the analytical standard of Isoniazid. This product is intended for research and analytical applications. Isoniazid (INH) is a proagent and must be activated by a bacterial catalase-peroxidase enzyme KatG. Isoniazid is bactericidal to rapidly dividing mycobacteria and has anti-tuberculostatic activity[1][2][3][4].

• HY-N1952R

  Isoeugenol (Standard)	Inhibitor
  Isoeugenol (Standard) is the analytical standard of Isoeugenol. This product is intended for research and analytical applications. Isoeugenol is an essential oil constituent of nutmeg, clove, and cinnamon. Isoeugenol inhibits growth of Escherichia coli and Listeria innocua with MICs of 0.6 mg/mL and 1 mg/mL, respectively[1].

• HY-N0650S12

  L-Serine-d3,15n
  L-Serine-15N,d3 is the deuterium and 15N labeled L-Serine[1]. L-Serine ((-)-Serine;(S)-Serine), one of the so-called non-essential amino acids, plays a central role in cellular proliferation[2].

• HY-N0012

  Glycitin	Inhibitor	99.71%
  Glycitin (Glycitein 7-O-β-glucoside) is a natural isoflavone with antibacterial, antiviral, anticancer, anti-inflammation, anti-aging and estrogenic effects. Glycitin may regulate osteoblasts through TGF-β or AKT signaling pathways in bone marrow stem cells (BMSCs)[1][2].

• HY-129819

  (Rac)-DNDI-8219	Inhibitor
  (Rac)-DNDI-8219 is an antituberculosis compound with potent anti-leishmanial activity. (Rac)-DNDI-8219 demonstrated superior efficacy in the Leishmania donovani mouse model. (Rac)-DNDI-8219 showed promising activity in the Leishmania infantum hamster model. (Rac)-DNDI-8219 candidate compound R-6 provided excellent oral efficacy in the same hamster model[1].

• HY-N6739

  Beauvericin	Inhibitor	99.97%
  Beauvericin is a cyclohexapeptide Fusarium toxin with insecticidal, antibacterial, anticancer, antiviral and cytotoxic activities. Beauvericin causes cellular genotoxicity by producing DNA breaks, chromosomal aberrations and micronuclei, and inhibits the PI3K/AKT pathway to induce apoptosis, thereby inhibiting the growth of HCC. In addition, Beauvericin affects immune function by inhibiting lymphocyte proliferation and interfering with the differentiation process of human monocytes into macrophages[1][2][3][4][5][6][7][8][9].

• HY-129434A

  4aα,7α,7aα-Nepetalactone	Inhibitor	99.69%
  4aα,7α,7aα-Nepetalactone exhibits antibacterial activity, and inhibits Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Salmonella typhi and Enterococcus faecalis.

• HY-17460A

  Garenoxacin Mesylate hydrate	Inhibitor	99.78%
  Garenoxacin (BMS284756) Mesylate hydrate is an orally active quinolone antibiotic and has a broad spectrum of activity against a wide array of gram-positive and gram-negative bacteria, anaerobes, and fastidious organisms[1].

• HY-P5738

  Palicourein	Inhibitor
  Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM[1].

• HY-126562

  Piperlonguminine	Inhibitor
  Piperlonguminine is an alkaloid amide isolated from the Piper species. Piperlonguminine shows various biological properties, including anti-inflammatory, antitumor, neuroprotective, anti-platelet, anti-melanogenic, antifungal and antibacterial activities[1][2][3][4].

• HY-P99954

  Rivabazumab pegol
  Rivabazumab pegol is a PcrV protein antibody that can be used to study the phase II pegylated Fab of chronic Pseudomonas aeruginosa infection[1].

• HY-146177

  CYP3A4 enzyme-IN-1	Inhibitor
  CYP3A4 enzyme-IN-1 (compound 59) is a potent antibacterial agent, with a MIC of 1 μg/mL for MRSA. CYP3A4 enzyme-IN-1 exhibits low to moderate inhibitory effects on CYP1A2, CYP2E1, CYP2D6, and CYP3A4 enzymes[1].

• HY-12326A

  c-di-AMP disodium		99.71%
  c-di-AMP (Cyclic diadenylate) sodium is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP sodium is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP sodium acts as a potent mucosal adjuvant stimulating both humoral and cellular responses[1][2][3][4].

• HY-14519A

  Methotrexate disodium		99.71%
  Methotrexate (Amethopterin) disodium, an antimetabolite and antifolate agent, inhibits the enzyme dihydrofolate reductase, thereby preventing the conversion of folic acid into tetrahydrofolate, and inhibiting DNA synthesis. Methotrexate disodium, also an immunosuppressant and antineoplastic agent, is used for the research of rheumatoid arthritis and a number of different cancers (such as acute lymphoblastic leukemia)[1][2][3].

• HY-B0108

  Daptomycin	Inhibitor	99.90%
  Daptomycin is a lipopeptide antibiotic with rapid in vitro bactericidal activity against gram-positive organisms.

• HY-14655R

  Sulfasalazine (Standard)	Inhibitor
  Sulfasalazine (Standard) is the analytical standard of Sulfasalazine. This product is intended for research and analytical applications. Sulfasalazine (NSC 667219) is an anti-rheumatic agent for the research of rheumatoid arthritis and ulcerative colitis. Sulfasalazine can suppress NF-κB activity. Sulfasalazine is a type 1 ferroptosis inducer[1][2][3][4].

• HY-B0771

  Cefozopran	Inhibitor
  Cefozopran (SCE-2787) is a semi-synthetic, parenteral, fourth-generation cephalosporin. Cefozopran, an antibiotic, has a broad spectrum of antibacterial activity, inhibiting most of the gram-negative and gram-positive organisms[1][2].

• HY-N0337

  Eugenol	Inhibitor	99.99%
  Eugenol is an essential oil found in cloves with antibacterial, anthelmintic and antioxidant activity. Eugenol is shown to inhibit lipid peroxidation.

• HY-B1794

  Thiethylperazine	Inhibitor	99.91%
  Thiethylperazine, a phenothiazine derivate, is an orally active and potent dopamine D2-receptor and histamine H1-receptor antagonist. Thiethylperazine is also a selective ABCC1activator that reduces amyloid-β (Aβ) load in mice. Thiethylperazine has anti-emetic, antipsychotic and antimicrobial effects[1][2][3].

• HY-149809

  AcrB-IN-1	Inhibitor
  AcrB-IN-1 (Compound H6) is a potent AcrB inhibitor. AcrB-IN-1 can be used for the reversal of bacterial multidrug resistance[1].

• HY-139745A

  FPI-1523	Inhibitor
  FPI-1523, a derivative of Avibactam, is a potent β-lactamase inhibitor, with Kds of 4 nM and 34 nM for CTX-M-15 and OXA-48, respectively. FPI-1523 also inhibits PBP2, with an IC50 of 3.2 μM. FPI-1523 exhibits considerable antimicrobial activity[1].

• HY-B0272S1

  Rifampicin-d8	Inhibitor
  Rifampicin-d8 (Rifampin-d8) is the deuterium labeled Rifampicin. Rifampicin is a potent and broad spectrum antibiotic against bacterial pathogens. Rifampicin has anti-influenza virus activities.

• HY-A0256

  Clavulanic acid	Inhibitor	99.76%
  Clavulanic acid is a naturally occurring powerful bacterial β-lactamases inhibitor for research of infections caused by bacteria, including infections of the ears. Clavulanic acid is active against a wide spectrum of gram-positive and gram-negative bacterias[1].

• HY-12764R

  6-OAU (Standard)	Inhibitor
  Prochloraz manganese (Standard) is the analytical standard of Prochloraz manganese. This product is intended for research and analytical applications. Prochloraz manganese is an antifungal agent, and is used in agricultural industries[1].

• HY-B1407

  Phthalylsulfathiazole	Inhibitor
  Phthalylsulfathiazole is a kind of sulfonamides used as an antibacterial drug.

• HY-103095

  Enmetazobactam	Inhibitor
  Enmetazobactam (AAI101) is an extended-spectrum β-lactamase inhibitor, against many resistant Gram-negative pathogens[1][2].

• HY-18714

  BRD7116	Inhibitor	99.73%
  BRD7116 competitively binds to bacterial DNA gyrase, exhibits an EC50 of 200 nM for LSCe cells, with cell-non-autonomous anti-leukemia activity.

• HY-107329R

  Cefathiamidine (Standard)	Inhibitor

• HY-14519CS

  (R)-Methotrexate-d3
  (R)-Methotrexate-d3 is the deuterium labeled (R)-Methotrexate[1].

• HY-106574

  Ceftobiprole medocaril	Inhibitor
  Ceftobiprole medocaril (BAL5788) is the parenteral proagent of Ceftobiprole (HY-112579). Ceftobiprole is a parenteral pyrrolidinone cephalosporin. Ceftobiprole is a broad-spectrum cephalosporin with high levels of in vitro activity against methicillin- (MRSA) and vancomycin-resistant staphylococci (VRSA) and penicillin-resistant streptococci. Ceftobiprole also inhibits gram-positive and gram-negative pathogens[1][2].

• HY-146496

  Antitubercular agent-20	Inhibitor
  Antitubercular agent-20 (Compound 2d) is an orally active antitubercular agent. Antitubercular agent-20 shows excellent activity against MTB H37Rv and MDR-MTB strains (MIC: ＜0.016 µg/ml). Antitubercular agent-20 has low cytotoxicity and good tolerance in BALB/c mice[1].

• HY-17021B

  Esomeprazole potassium salt		98.18%
  Esomeprazole potassium salt ((S)-Omeprazole potassium salt) is a potent and orally active proton pump inhibitor and reduces acid secretion through inhibition of the H+, K+-ATPase in gastric parietal cells. Esomeprazole potassium salt has the potential for symptomatic gastroesophageal reflux disease research[1][2][3].

• HY-B1902

  Diaveridine		99.79%
  Diaveridine (EGIS-5645) is a dihydrofolate reductase (DHFR) inhibitor with a Ki of 11.5 nM for the wild type DHFR and also an antibacterial agent.

• HY-W129471

  2-Pentadecanone	Inhibitor	99.97%
  2-Pentadecanone (Pentadecan-2-one) is a fragrance ingredient and can be used as a food additive[1].

• HY-N6606

  Delphinidin-3-O-galactoside chloride		98.70%
  Delphinidin-3-O-galactoside (chloride) is an anthocyanin that extracts from wheat flour. Delphinidin-3-O-galactoside (chloride) can be used for the research of antioxidant and antimicrobial[1].

• HY-N10560

  Wychimicin C	Inhibitor
  Wychimicin C is a spirotetronate polyketide, can be isolated from the rare actinomycete Actinocrispum wychmicini strain MI503-AF4. Wychimicin C shows strong antibacterial activity against methicillin-resistant Staphylococcus. aureus (IC50=0.125-0.5 μg/mL) and Enterococcus. faecalis/faecium (IC50=0.125-0.25 μg/mL)[1][2].

• HY-146426

  MraY-IN-2	Inhibitor
  MraY-IN-2 (compound 6) is a potent MurNAc-pentapeptide translocase (MraY) inhibitor with an IC50 value of 4.5 μM. MraY-IN-2 can be used for researching anti-bacteria[1].

• HY-119172

  NSC-60339	Inhibitor
  NSC-60339, an efflux pump inhibitor and a substrate of AcrAB-TolC, is a polybasic terephthalic acid derivative studied as a potential cancer chemotherapeutic agent[1][2].

• HY-P4820A

  SYNV-cyclo(CGGYF) TFA	Inhibitor
  SYNV-cyclo(CGGYF) TFA is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) TFA inhibits S. aureus activity. SYNV-cyclo(CGGYF) TFA has the potential for the research of S. aureus-mediated epithelial damage and inflammation[1].

• HY-W013766R

  Pipemidic acid (trihydrate) (Standard)	Inhibitor
  Pipemidic acid (trihydrate) (Standard) is the analytical standard of Pipemidic acid (trihydrate). This product is intended for research and analytical applications. Pipemidic acid trihydrate, a derivative of Piromidic acid, is an antibacterial agent. Pipemidic acid trihydrate inhibits DNA gyrase. Pipemidic acid trihydrate is active against gram-negative bacteria including Pseudomonas aeruginosa as well as some gram-positive bacteria. Pipemidic acid trihydrate can be used for the research of intestinal, urinary, and biliary tract infections[1][2].

• HY-N0414R

  Trigonelline (Standard)	Inhibitor
  Trigonelline (Standard) is the analytical standard of Trigonelline. This product is intended for research and analytical applications. Trigonelline is an alkaloid with potential antidiabetic activity that can be isolated from Trigonella foenum-graecum L or Leonurus artemisia. Trigonelline is a potent Nrf2 inhibitor that blocks Nrf2-dependent proteasome activity, thereby enhancing apoptosis in pancreatic cancer cells. Trigonelline also has anti-HSV-1, antibacterial, and antifungal activity and induces ferroptosis.

• HY-B0421

  Mycophenolic acid	Inhibitor	99.87%
  Mycophenolic acid is a potent uncompetitive inosine monophosphate dehydrogenase (IMPDH) inhibitor with an EC50 of 0.24 µM. Mycophenolic acid demonstrates antiviral effects against a wide range of RNA viruses including influenza. Mycophenolic acid is an immunosuppressive agent. Antiangiogenic and antitumor effects[1][2].

• HY-101985

  BV02	Inhibitor
  BV02 is a 14-3-3 inhibitor and an antibacterial agent. BV02 enhances the cleavage of PARP and caspase-3. BV02 induces Apoptosis, Autophagy, and enhances Akt activation. BV02 has anti-B. melitensis infection and epilepsy-promoting effects. BV02 can also be used in colitis research.

• HY-136409R

  N-Decanoyl-L-homoserine lactone (Standard)	Inhibitor
  Formoterol (hemifumarate hydrate) (Standard) is the analytical standard of Formoterol (hemifumarate hydrate). This product is intended for research and analytical applications. Formoterol hemifumarate hydrate is a selective, long-acting beta 2-adrenoceptor agonist. Formoterol is a bronchodilator used for the research of the asthma and chronic obstructive pulmonary disease (COPD). Formoterol hemifumarate hydrate induces mitochondrial biogenesis and promotes cognitive recovery after traumatic brain injury[1][2][3].

• HY-156975

  Sulfatrozole
  Sulfatrozole is a sulfanilamide derivative. Sulfatrozole is an antimicrobial agent with broad-spectrum activity[1].

• HY-30235A

  Benzydamine hydrochloride	Inhibitor	98.22%
  Benzydamine hydrochloride is an orally administered prostaglandin synthesis inhibitor that has anti-inflammatory, analgesic, antipyretic, and antibacterial properties. Benzydamine hydrochloride can inhibit TNF-α, stabilize cell membranes, and reduce oxidative stress within cells[1][2][3].

• HY-151204

  PknB-IN-1	Inhibitor
  PknB-IN-1 (Compound 2) is a protein kinase B (PknB) inhibitor (IC50=14.4 μM). PknB-IN-1 shows anti-mycobacterial activity, can inhibit M. tuberculosis H37Rv strain growth (MIC=6.2 μg/mL)[1].

• HY-B0306

  Prothionamide	Inhibitor	99.94%
  Protionamide (prothionamide) acts on tuberculosis and leprosy.

• HY-N1210

  Spiramine A
  Spiramine A (Spiramine C acetate (ester)) is a diterpene alkaloid with antitumor and antimicrobial activity. Spiramine A inhibits PAF-induced rabbit platelet aggregation in a concentration-dependent manner, with an IC50 vallue of 6.7 μM[1].

• HY-152105

  Metallo-β-lactamase-IN-9	Inhibitor
  Metallo-β-lactamase-IN-9 (Compound 23) is a pan metallo-beta-lactamase (MBL) inhibitor with IC50s of 35, 269 and 369 nM against NDM-1, VIM-1 and IMP-1, respectively[1].

• HY-10882S1

  Clotrimazole-d10	Inhibitor
  Clotrimazole-d10 is deuterated labeled Clotrimazole (HY-10882). Clotrimazole is an imidazole derivative, an antifungal compound and is a CYP (cytochrome P450) inhibitor. Clotrimazole has antibacterial activity.

• HY-P10539

  Hp1404	Inhibitor
  Hp1404 is a novel cationic antimicrobial peptide. Hp1404 has specific inhibitory activity against Gram-positive bacteria, including Staphylococcus aureus (MRSA) resistant to Laburnetin (HY-N7382). Hp1404 has antimicrobial activity, low toxicity, and is not prone to drug resistance, and can be used in the research of antimicrobial agents[1].

• HY-B1924

  Norvancomycin hydrochloride	Inhibitor
  Norvancomycin hydrochloride is suitable for endocarditis, osteomyelitis, pneumonia, sepsis or soft tissue infections caused by Staphylococcus aureus (including methicillin-resistant strains and multi-drug-resistant strains).

• HY-14738

  Ceftaroline fosamil (inner)	Inhibitor
  Ceftaroline fosamil (inner) (TAK-599 free acid), a cephalosporin derivative, is an N-phosphono proagent of anti-methicillin-resistant Staphylococcus aureus (MRSA) T-91825. Ceftaroline fosamil (inner) can be used for the research of MRSA infection[1][2][3].

• HY-163181

  MSU-43085	Inhibitor
  MSU-43085 is an orally active MmpL3 inhibitor of Mycobacterium tuberculosis (Mtb). MSU-43085 effectively inhibits Mtb in an acute murine tuberculosis infection model. MSU-43085 can be used in tuberculosis research[1].

• HY-129691

  Ro 14-1761	Inhibitor
  Ro 14-1761 is a third-generation cephalosporin with antibacterial activity[1].

• HY-158124

  LasR antagonist 1	Antagonist
  LasR antagonist 1 (Compound 7) is an antagonist for LasR with an IC50 of 0.4 μM, that modulates the quorum sensing (QS) in the opportunistic pathogen Pseudomonas aeruginosa[1].

• HY-149149

  Incadronic acid	Inhibitor
  Incadronic acid inhibits growth of Dictyostelium discoideum with an IC50 of 1.6 μM. Incadronic acid binds the farnesyl diphosphate synthase (FPPS) in Leishmania major with the Ki of 23 nM. Incadronic acid inhibits the bone resorption and reduces bone loss, that can be used in osteoporosis research. Incadronic acid inhibits the proliferation of cells RAW264.7, PC-3 and MCF-7 with IC50 of 48 to 228.6 µM[1].

• HY-N2984

  Calanolide E	Inhibitor
  Calanolide E is a natural coumarin with weakly inhibitory towards the Bacilli strains with MIC values ranging from 0.25-0.50 mg/mL[1].

• HY-P6012A

  SAIRGA TFA	Inhibitor	99.62%
  SAIRGA (TFA), derived from the phages phi3T, can recognize phAimR in the bacterial cytosol to induce lysogeny[1].

• HY-N9448

  Lacto-N-tetraose	Inhibitor
  Lacto-N-tetraose is the significant core structure of human milk oligosaccharides (HMOs) naturally existing in human milk. Lacto-N-tetraose is consist of galactose, N-acetylglucosamine, and glucose moieties. Lacto-N-tetraose has prebiotic effect, immune regulatory effect, anti-inflammatory effects, intestinal cell responses regulatory effect, antibacterial activity and antiviral activity. Lacto-N-tetraose has been widely added to infant formula[1].

• HY-N6680R

  Virginiamycin S1 (Standard)	Inhibitor
  Virginiamycin S1 (Standard) is the analytical standard of Virginiamycin S1. This product is intended for research and analytical applications. Virginiamycin S1 is a cyclic hexadepsipeptide antibiotic, inhibits bacterial protein synthesis at the level of aminoacyl-tRNA binding and peptide bond formation. Virginiamycin S1 belongs to the type B compounds in the streptogramin family and is produced by Streptomyces virginiae, shows a strong bactericidal activity against a wide range of Gram-positive bacteria. Virginiamycin S1 together with virginiamycin M1 is more effective in treat multidrug-resistant bacterial infections[1][2].

• HY-B1526

  Thiacetazone	Inhibitor	99.73%
  Thiacetazone (Thioacetazone) is a thiourea-containing antitubercular agent and is an orally active antibiotic. Thiacetazone has antibacterial action, which inhibits growth of Mycobacterium tuberculosis H37Rv with a MIC value of 0.1 μg/mL[1].

• HY-66011AS

  Moxifloxacin-d4	Inhibitor
  Moxifloxacin-d4 is the deuterium labeled Moxifloxacin. Moxifloxacin is an orally active 8-methoxyquinolone antimicrobial for use in the treatment of acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1][2].

• HY-129347

  Lankacyclinol A	Inhibitor
  Lankacyclinol A is an orally active antibiotic isolated from Streptomyces rochei. Lankacyclinol A has broad-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria. Lankacyclinol A exhibits low toxicity in mice[1].

• HY-B0239S1

  DL-threo-Chloramphenicol-d5
  DL-threo-Chloramphenicol-d5 is a deuterium labeled DL-threo-Chloramphenicol. DL-threo-Chloramphenicol is the racemate of Chloramphenicol.

• HY-W269799

  4-Pentenyl isothiocyanate	Inhibitor
  4-Pentenyl isothiocyanate is a isothiocyanates isolated from aerial parts of Aurinia sinuate[1].

• HY-163292

  Antibacterial agent 180	Inhibitor
  Antibacterial agent 180 (15g), an appropriate substrate for the type I nitro reductases (TcNTR I), is a promising antitrypanosomatid agent. Antibacterial agent 180 (15g) shows nonmutagenic potential against Salmonella typhimurium strains (TA98, TA100, and TA102)[1].

• HY-N2552R

  Vitamin K5 (hydrochloride) (Standard)	Inhibitor

• HY-W739149

  Rifapentine-d8	Inhibitor
  Rifapentine-d8 is deuterium labeled Rifapentine. Rifapentine (DL 473) is an antibiotic used in tuberculosis research[1][2].

• HY-108527

  CD1530	Inhibitor
  CD1530 is an orally active, selective RARγ agonist and antibacterial agent. CD1530 reduces Smad1/5/8 phosphorylation and overall Smad levels. CD1530 reduces β-catenin, MMP9 protein, and ROS levels. CD1530 exhibits activities such as inhibiting heterotopic ossification, promoting Achilles tendon healing, and inhibiting muscle fatty infiltration. CD1530 can be used in the research of orthopedic diseases (such as heterotopic ossification, Achilles tendon injury), muscle diseases (such as muscle fatty infiltration-related diseases)[1][2][3][4][5][6].

• HY-W150677

  BioA-IN-1	Inhibitor	99.24%
  BioA-IN-1 (Compound 15) is an inhibitor of BioA, a key enzyme in the biotin synthesis pathway of Mycobacterium tuberculosis, with an IC50 value of 0.195 μM. BioA-IN-1 exhibits antibacterial activity but has no cytotoxicity[1].

• HY-B0992R

  Nithiamide (Standard)	Inhibitor
  Nithiamide (Standard) is the analytical standard of Nithiamide. This product is intended for research and analytical applications. 0

• HY-N8336

  IT-143A	Inhibitor
  IT-143A is an antibiotic, that exhibits antibacterial and antifungal activity against Micrococcus luteus and Aspergillus fumigatus with MIC of 6.25-25 μg/mL. IT-143A inhibits growth of cancer cell KB with an IC50 of 0.36 ng/mL[1].

• HY-168956

  Pks13-IN-2	Inhibitor
  Pks13-IN-2 (Compound 43) is an orally active inhibitor of Pks13. Pks13-IN-2 exhibits inhibitory activity against Mycobacterium tuberculosis H37Rv, with a MIC of 0.8-1.8 μM. Pks13-IN-2 shows good metabolic stability in mouse liver microsomes and hepatocytes. Pks13-IN-2 can be used for tuberculosis research[1].

• HY-108288

  Sulbactam pivoxil
  Sulbactam pivoxil is a proagent of sulbactam. Sulbactam is a β-lactamase inhibitor which poorly adsorbed from gastrointestinal tract. Sulbactam pivoxil has a better absorption than the parent agent and provides high serum levels after oral administration[1].

• HY-116961

  TH1020	Inhibitor	99.81%
  TH1020 is a potent and selective toll-like receptor 5 (TLR5)/flagellin complex antagonist with an IC50 of 0.85 μM. TH1020 inhbits flagellin-induced TLR5 signaling. TH1020 is inactive against TLR2, TLR3, TLR4, TLR7 and TLR8[1].

• HY-162527

  Antibacterial agent 216	Inhibitor
  Antibacterial agent 216 (Compound 2a) is an antibacterial agent that exhibits significant bactericidal effects when combined with INH and RIF. Antibacterial agent 216 has demonstrated remarkable in vitro anti-tuberculosis activity against Mtb H37Rv and MDR clinical isolates and can be used for tuberculosis research[1].

• HY-13756R

  Tacrolimus (Standard)	Inhibitor
  Tacrolimus (Standard) is the analytical standard of Tacrolimus. This product is intended for research and analytical applications. Tacrolimus (FK506), a macrocyclic lactone, binds to FK506 binding protein (FKBP) to form a complex. Tacrolimus inhibits calcineurin phosphatase, which inhibits T-lymphocyte signal transduction and IL-2 transcription. Immunosuppressive properties[1].

• HY-W749146

  Raja 42	Inhibitor
  Raja 42 is a gamma lactam antibiotic. Raja 42 is effective against a variety of different bacterias, including Gram-positive and Gram-negative bacteria, such as C. difficile strains[1].

• HY-17021R

  Esomeprazole (Standard)
  Esomeprazole (Standard) is the analytical standard of Esomeprazole. This product is intended for research and analytical applications. Esomeprazole ((S)-Omeprazole) is a potent and orally active proton pump inhibitor and reduces acid secretion through inhibition of the H+, K+-ATPase in gastric parietal cells. Esomeprazole has the potential for symptomatic gastroesophageal reflux disease research[1][2][3].

• HY-170312

  Antimicrobial-IN-1	Inhibitor
  Antimicrobial-IN-1 (compound 17) exhibits strong antibacterial activity against S. aureus and E. coli, with the inhibition zone diameter of 18 , 16 mm/mg, respectively[1].

• HY-B0272

  Rifampicin	Inhibitor	98.15%
  Rifampicin is a potent and broad spectrum antibiotic against bacterial pathogens. Rifampicin has anti-influenza virus activities. Rifampicin shows anti-orthopoxvirus activity.

• HY-147089

  PRRSV/CD163-IN-1	Inhibitor	98.55%
  PRRSV/CD163-IN-1 is a PRRSV/CD163 inhibitor. PRRSV/CD163-IN-1 can inhibit the interaction between the PRRSV glycoprotein (GP2a or GP4) and the CD163-SRCR5 domain. PRRSV/CD163-IN-1 can be used for the research of porcine reproductive and respiratory syndrome (PRRS) [1].

• HY-B1210

  Pipemidic acid	Inhibitor
  Pipemidic acid , a derivative of Piromidic acid, is an antibacterial agent. Pipemidic acid inhibits DNA gyrase. Pipemidic acid is active against gram-negative bacteria including Pseudomonas aeruginosa as well as some gram-positive bacteria. Pipemidic acid can be used for the research of intestinal, urinary, and biliary tract infections[1][2].

• HY-P5465

  Lactoferricin H, Lactotransferrin (37-61), human	Inhibitor
  Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)

• HY-A0269R

  Mecillinam (Standard)	Inhibitor
  Mecillinam (Standard) is the analytical standard of Mecillinam. This product is intended for research and analytical applications. Mecillinam (Amdinocillin), the β-lactam antibiotic, has a broad spectrum of activity against gram-negative organisms[1].

• HY-170609

  Antimicrobial agent-36	Inhibitor
  Antimicrobial agent-36 (Compound 8b) is an antimicrobial agent that significantly inhibits the level of DNA gyrase, with an IC50 value of 4.56 µM. Antimicrobial agent-36 can also be used for the preparation of nanopharmaceutical formulations, for the research and development of novel antibiotics[1].

• HY-17517

  Tiadinil	Inhibitor	99.84%
  Tiadinil is a plant activator of systemic acquired resistance, boosts the production of herbivore-induced plant volatiles; fungicide.

• HY-101472

  Closthioamide	Inhibitor
  Closthioamide is a potent inhibitor of bacterial DNA gyrase and highly active against Ec, MRSA, VRE and Mv), with MICs of 9.00 μM, 0.58 μM, 0.58 μM and 72.03 μM respectively.

• HY-P10402

  BMAP 28 (bovine)	Inhibitor
  BMAP 28, bovine is an antibacterial peptide. BMAP 28, bovine exhibits antimicrobial activity against gram-positive and gram-negative bacteria, by increasing cell membrane permeability, and causing leakage of cell contents. BMAP 28, bovine exhibits cytotoxicity to cancer cells and activated human lymphocytes. BMAP 28, bovine induces apoptosis through depolarization of mitochondrial membrane potential[1][2][3].

• HY-126407

  Secologanin dimethyl acetal	Inhibitor
  Secologanin dimethyl acetal (Compound Ⅱ) is an iridoid glucoside that can be isolated from Pterocephalus perennis. Secologanin dimethyl acetal shows antimicrobial activity against S.aureus and S.epidermidi[1].

• HY-N1984R

  Artemisic acid (Standard)	Inhibitor

• HY-N13887

  Aerocyanidin	Inhibitor
  Aerocyanidin is an antibiotic containing an isonitrile group, which is mainly effective against Gram-positive bacteria.

• HY-B1802B

  Tosufloxacin hydrochloride	Inhibitor
  Tosufloxacin (A-61827) hydrochloride is an orally active fluoroquinolone antibiotic. Tosufloxacin hydrochloride shows a broad spectrum of antibacterial activity against gram-positive and gram-negative bacteria[1][2].

• HY-N0683A

  rel-α-Vitamin E	Inhibitor
  rel-α-Vitamin E (rel-D-α-Tocopherol) is a vitamin with antioxidant properties and also a mixture[1].

• HY-143290

  Antibacterial agent 118	Inhibitor
  Antibacterial agent 118 (compound 20) is an antimycobacterial agent. Antibacterial agent 118 shows antibacterial activity against Mtb H37Ra, M. aurum, M. smegmatis, Mtb H37Rv and M. avium with MIC values of 40.7, 10.2, 163.0, 62.5 and 62.5 μM, respectively. Antibacterial agent 118 can be used for the research of tuberculosis[1].

• HY-P3979

  Defensin HNP 4	Inhibitor
  Defensin HNP 4 (HNP 4) is a single 11 amino acid long fragment of HNP-41-11. Defensin HNP 4 has inhibitory effect against multidrug-resistant and non-resistant strains[1].

• HY-B1781

  Sulfachloropyridazine	Inhibitor	99.51%
  Sulfachloropyridazine is a broad spectrum sulfonamide used against both Gram-positive and Gram-negative aerobic bacteria.

• HY-B0220C

  Erythromycin (aspartate)	Inhibitor
  Erythromycin aspartate is a macrolide antibiotic produced by actinomycete?Streptomyces erythreus?with a broad spectrum of antimicrobial activity. Erythromycin aspartate binds to bacterial 50S ribosomal subunits and inhibits?RNA-dependent protein synthesis?by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid[1][2]. Erythromycin aspartate also exhibits antitumor and neuroprotective effect in different fields of research[3][4].

• HY-B0934S

  Ethylparaben-d4
  Ethylparaben-d4 is the deuterium labeled Ethylparaben[1].

• HY-B0450

  Ciclopirox	Inhibitor	99.84%
  Ciclopirox (HOE296b) is a synthetic and orally active antifungal agent that can be used for superficial mycoses reseaech. Ciclopirox olamine has a very broad spectrum of activity and inhibits dermatophytes, yeasts, molds, and many Gram-positive and Gram-negative species pathogenic. Ciclopirox also has anticancer and anti-inflammatory effect[1][2][3].

• HY-10393

  Eperezolid	Inhibitor
  Eperezolid(PNU-100592) is a oxazolidinone antibacterial agent, Eperezolid demonstrated good in vitro inhibitory activity, regardless of methicillin susceptibility for staphylococci(MIC90= 1-4 mg/ml).

• HY-N2011

  Octyl gallate	Inhibitor	98.01%
  Octyl gallate (Progallin O) is widely used as a food additive, with antimicrobial and antioxidant activity[1][2]. Octyl gallate (Progallin O) shows selective and sensitive fluorescent property[2]. Octyl gallate shows a marked antiviral effect against HSV-1, vesicular stomatitis virus (VSV) and poliovirus[3].

• HY-N6779

  Patulin	Inhibitor
  Patulin (Terinin) is a mycotoxin produced by fungi including the Aspergillus, Penicillium, and Byssochlamys species, causes chromosome breakage, mutation, teratogenic and cytotoxic. Patulin induces autophagy-dependent apoptosis through lysosomal-mitochondrial axis, and causes DNA damage[1][2][3][4].

• HY-B0935

  Benzyl benzoate	Inhibitor	99.94%
  Benzyl benzoate (Phenylmethyl benzoate) is an orally active anti-scabies agent, acaricide (EC50= 0.06 g/m2) and fungicide. Benzyl benzoate is an angiotensin II (Ang II) inhibitor with antihypertensive effects. Benzyl benzoate can be used in perfumes, pharmaceuticals and the food industry[1][2][3][4][5].

• HY-112661

  PC-766B	Inhibitor
  PC-766B is a macrolide antibiotic. PC-766B is active against Gram-positive bacteria, and some fungi and yeasts, but inactive against Gram-negative bacteria. PC-766B shows antitumor activity against murine tumor cells. PC-766B has weak inhibitory activity against Na+, K+-ATPase[1][2].

• HY-N0465R

  Olaquindox (Standard)	Inhibitor
  Olaquindox (Standard) is the analytical standard of Olaquindox. This product is intended for research and analytical applications. Olaquindox, a quinoxalin derivative, is an orally active antibiotic. Olaquindox stimulates growth and decreases intestinal mucosal immunity of piglets[1].

• HY-B0525

  Carbenicillin	Inhibitor
  Carbenicillin is a broad-spectrum semi-synthetic penicillin antibiotic for gram-negative bacteria. Carbenicillin can interfere the cell wall synthesis while displaying low toxicity to plant tissue[1][2].

• HY-P5664

  Maximin S4	Inhibitor
  Maximin S4 is an antimicrobial peptide derived from toad Bombina maxima. Maximin S4 has antibacterial activity against mycoplasma[1].

• HY-13434AR

  Ionomycin (calcium) (Standard)	Inhibitor
  2-(1-Piperazinyl)pyrimidine (Standard) is the analytical standard of 2-(1-Piperazinyl)pyrimidine. This product is intended for research and analytical applications. 2-(1-Piperazinyl)pyrimidine is the major metabolite of Tandospirone (HY-14558)[1].

• HY-126605

  Trinactin	Inhibitor
  Trinactin is a macrotetrolide antibiotic. Trinactin also is a cation carrier[1][2].

• HY-B2157R

  Robenidine hydrochloride (Standard)	Inhibitor
  Robenidine hydrochloride (Standard) is the analytical standard of Robenidine hydrochloride. This product is intended for research and analytical applications. Robenidine hydrochloride is an anticoccidial agent which is also active against MRSA and VRE with MIC50s of 8.1 and 4.7 μM, respectively.

• HY-B0512R

  Sulfamerazine (Standard)	Inhibitor
  Sulfamerazine (Standard) is the analytical standard of Sulfamerazine. This product is intended for research and analytical applications. 0

• HY-139764

  Antibacterial agent 47	Inhibitor
  Antibacterial agent 47, an antibacterial agent, significantly lowers MIC value of antibacterial agent Ceftazidime[1].

• HY-P2824

  Streptokinase, β-hemolytic streptococcus (Lancefield Group C)	Inhibitor
  Streptokinase, β-hemolytic streptococcus (Lancefield Group C) is a bacteria-derived protein and a plasminogen activator. Streptokinase is widely used for the research of the blood-clotting disorders. Streptokinase improves reperfusion blood flow after coronary artery occlusion[1][2].

• HY-N0262R

  Cordycepin (Standard)	Inhibitor
  Cordycepin (Standard) is the analytical standard of Cordycepin. This product is intended for research and analytical applications. Cordycepin (3'-Deoxyadenosine) is a nucleoside derivative and inhibits IL-1β-induced MMP-1 and MMP-3 expression in rheumatoid arthritis synovial fibroblasts (RASFs) in a dose-dependent manner[1]. Cordycepin kills Mycobacterium tuberculosis through hijacking the bacterial adenosine kinase[2].

• HY-105088A

  Pexiganan acetate	Inhibitor
  Pexiganan acetate (MSI 78) is the acetate salt form of Pexiganan (HY-105088). Pexiganan acetate is an orally active broad-spectrum antimicrobial peptide, which inhibits 99% gram-positive and Gram-negative aerobic bacteria through disruption of cell membrane/cells permeability. Pexiganan acetate can be used in the research of infections, such as diabetic foot ulcer infections[1].

• HY-N15095

  Aplasmomycin	Inhibitor
  Aplasmomycin is a boron-containing macrodiolide antibiotic. Aplasmomycin shows antimicrobial activity against Gram-positive bacteria and exhibits inhibitory activity against plasmodium infections in vivo[1].

• HY-145881

  Elongation factor P-IN-2
  Elongation factor P-IN-2 is a potent inhibitor elongation factor P (EFP). Elongation factor P-IN-2 is a β-lysine derivative compound. Elongation factor P-IN-2 affects the proliferation rates of E. coli[1].

• HY-N8281

  Daldinone A	Inhibitor
  Daldinone A (Compound 4) is an antibacterial agent that can be isolated from Nigrospora oryzae. Daldinone A has antimicrobial potential against P. aeruginosa[1].

• HY-121341

  Brodimoprim	Inhibitor	99.36%
  Brodimoprim (Ro 10-5970), a trimethoprim analogue, is an orally active dihydrofolate reductase inhibitor. Brodimoprim is highly active against a broad spectrum of gram-negative and gram-positive bacteria[1].

• HY-162429

  Antibacterial agent 205	Inhibitor
  Antibacterial agent 205 (Compound 10d) is a indolylacryloyl-derived oxacins, which exhibits broad antibacterial spectrum with MIC of 0.25-0.5 μg/mL. Antibacterial agent 205 reduces the exopolysaccharide, eliminates the biofilm, and thus attenuates the drug resistance. Antibacterial agent 205 exhibits antibacterial activity through destory of membrane integrity, accumulation of reactive oxygen species ROS, and inhibition of DNA replication[1].

• HY-B1422

  9-Aminoacridine	Inhibitor	99.35%
  9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections[1][2][3].

• HY-A0251R

  Cefpodoxime (Standard)	Inhibitor
  Cefpodoxime (Standard) is the analytical standard of Cefpodoxime. This product is intended for research and analytical applications. Cefpodoxime (Cefpodoxime acid) is a potent antibiotic active against gram-positive and gram-negative bacteria. Cefpodoxime inhibits the majority of cells in microbial populations. Cefpodoxime can be used for acute otitis media, sinusitis and tosillopharyngitis research[1][2].

• HY-128780B

  SPR206 acetate	Inhibitor	99.74%
  SPR206 acetate is a polymyxin analog with antibiotic activity against Gram-negative pathogens, including multidrug-resistant (MDR) variants. SPR206 acetate has an anti-bacterial infection effect by interacting with the bacterium’s outer membrane. The MIC values of SPR206 acetate against Pseudomonas aeruginosa Pa14 and Acinetobacter baumannii NCTC13301 are both 0.125 mg/L[1][2].

• HY-163111

  Antibacterial agent 170	Inhibitor
  Antibacterial agent 170 (compound 6b) is a potent antibacterial agent which inhibits the formation of P. aeruginosa PAO1 biofilm. Antibacterial agent 170 exhibits quorum sensing inhibitor effect by the las system. Antibacterial agent 170 can used in study microbial resistance[1].

• HY-N0565

  Doxycycline	Inhibitor
  Doxycycline, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-B0281A

  Ranitidine hydrochloride	Inhibitor
  Ranitidine hydrochloride is a potent, selective and orally active histamine H2-receptor antagonist with an IC50 of 3.3 μM that inhibits gastric secretion. Ranitidine hydrochloride is a weak inhibitor of CYP2C19 and CYP2C9[1][2].

• HY-W714002

  Feglymycin	Inhibitor
  Feglymycin is a HIV replication inhibitor. Feglymycin is also an antibiotic peptide that has antibacterial activity (MIC: 32-64 μg/mL for Staphylococcus aureus)[1].

• HY-101040A

  Telacebec ditosylate	Inhibitor
  Telacebec ditosylate is a midazopyridine amide compound. Telacebec ditosylate is active against Mycobacterium tuberculosis H37Rv with an MIC50 of 2.7 nM in culture broth medium.

• HY-B0126AS

  Marbofloxacin-d8 hydrochloride	Inhibitor
  Marbofloxacin-d8 (hydrochloride) is deuterium labeled Marbofloxacin (hydrochloride). Marbofloxacin hydrochloride is a third generation fluoroquinolone and orally active antimicrobial agent, which has a broad spectrum bactericidal activity and good efficacy. Marbofloxacin hydrochloride can be used for the research of infections by Gram-positive and Gram-negative bacteria and Mycoplasma[1][2][3][4].

• HY-100589

  Isepamicin sulfate	Inhibitor
  Isepamicin sulfate (Sch 21420 sulfate) is a broad spectrum aminoglycoside antibiotic. Isepamicin sulfate exhibits considerable antimicrobial activity against Gram-negative non-fermenters in a region with high antimicrobial resistance[1][2].

• HY-B1064R

  Clindamycin phosphate (Standard)	Inhibitor
  Clindamycin phosphate (Standard) is the analytical standard of Clindamycin phosphate. This product is intended for research and analytical applications. Clindamycin phosphate (Clindamycin 2-phosphate) is a broad-spectrum bacteriostatic lincosamide antibiotic. Clindamycin phosphate is the proagent of Clindamycin (HY-B1455) with no antimicrobial activity in vitro but can be rapidly converted in vivo to the active parent agent, Clindamycin, by phosphatase ester hydrolysis. Clindamycin phosphate can be used for researching acne and bacterial vaginosis[1][2][3].

• HY-15025AS

  Sildenafil citrate-d8
  Sildenafil (citrate)-d8 is the deuterium labeled Sildenafil citrate[1]. Sildenafil citrate is a potent phosphodiesterase type 5 (PDE5) inhibitor with IC50 of 5.22 nM.

• HY-B1459AS

  Dicloxacillin-13C4
  Dicloxacillin-13C4 is the 13C labeled Dicloxacillin[1]. Dicloxacillin is a β-lactam antibiotic of the penicillin family. Dicloxacillin against Gram-positive bacteria. Dicloxacillin is active against β-lactamase-producing organisms such as Staphylococcus aureus[2].

• HY-126732

  L-640876	Inhibitor
  L-640876 is a broad-spectrum and orally active lactam antimicrobial agent. L-640876 showa MIC90 of 0.125 pg/mL for the E. coli strains, 2 /mg/mL for the S.choleraerai strains and 4 pg/mL for the S. typhinwrium strains[1].

• HY-P2124

  Cyclo(L-Trp-L-Trp)	Inhibitor	99.81%
  Cyclo(L-Trp-L-Trp) is an antibiotic, and shows antimicrobial activity. Cyclo(L-Trp-L-Trp) can inhibit A. baumannii, as well as Candida albicans, Bacillus subtilis, Micrococcus luteus, Saccharomyces cerevisiae, Aspergillus niger, Staphylococcus aureus. Cyclo(L-Trp-L-Trp) can be used in microbial infection research[1].

• HY-14814

  Delafloxacin	Inhibitor	99.84%
  Delafloxacin (RX-3341; WQ-3034; ABT492) is a broad-spectrum fluoroquinolone antibiotic. Delafloxacin has a broad spectrum of activity that includes drug-resistant Staphylococcus aureus, Streptococcus pneumoniae, and Klebsiella pneumonia[1].

• HY-P1222

  LL-37, human	Inhibitor	99.60%
  LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing[1][2][3].

• HY-19487

  Ribocil	Inhibitor
  Ribocil is a highly selective chemical regulator that regulates the bacterial riboflavin nuclear switch. Ribocil strongly inhibits GFP expression with an EC50 value of 0.3 μM.

• HY-N6807S

  Elemicin-d3	Inhibitor
  Elemicin-d3 is deuterated labeled Pemafibrate (HY-17618). Pemafibrate is a highly selective PPARα agonist, with an EC50 of 1 nM.

• HY-153571

  Homo-BacPROTAC6	Inhibitor
  Homo-BacPROTAC6 is a ClpC1NTD BacPROTAC degrader and can targets ClpC2. Homo-BacPROTAC7 efficiently kill M. tuberculosis[1].

• HY-130839

  LolCDE-IN-1	Inhibitor	99.79%
  LolCDE-IN-1 is an inhibitor of the Lol proteins (LolCDE) complex, with antibacterial activity[1].

• HY-N8520

  Variculanol	Inhibitor
  Variculanol is an antimicrobial, anticancer and anti-HCV NS3/4A Protease agent which can be extracted from marine fungus Aspergillus versicolor[1].

• HY-N13301

  Aloe vera	Inhibitor
  Aloe vera is an herbal plant known for its anti-inflammatory, antibacterial, anticancer, antioxidant, heart-protective, and wound-healing properties. Aloe vera can be used in research for tumors, diabetes, bone diseases, and cardiovascular diseases[1].

• HY-A0163CR

  trans-Clopenthixol (dihydrochloride) (Standard)	Inhibitor

• HY-121349

  Aerothionin	Inhibitor
  Aerothionin is an antibiotic with potent antimicrobial efficacy against bacteria and fungi. Aerothionin exhibits antitumor efficacy against adrenal pheochromocytomas and extra-adrenal paragangliomas (PPGLs)[1][2].

• HY-17586AS

  Dalbavancin-d6
  Dalbavancin-d6 is the deuterium labeled Dalbavancin[1]. Dalbavancin (MDL-63397) is a semisynthetic lipoglycopeptide antibiotic with potent bactericidal activity against Gram-positive bacteria. Dalbavancin inhibits Staphylococcus aureus and Bacillus anthracis with MIC90s of 0.06 μg/mL and 0.25 μg/mL, respectively[2][3].

• HY-W403633

  Hexahydrohippuric acid	Inhibitor
  Hexahydrohippuric acid is a metabolite of Shikimate acid in both liver and kidney, under microbial metabolism effect. Hexahydrohippuric acid is made of cyclohexane carboxylic acid and glycinamide, and shows antibacterial activity[1][2].

• HY-P10230

  Sublancin	Inhibitor
  Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM[1][2].

• HY-125461

  Altersolanol A	Inhibitor
  Altersolanol A (Stemphylin; NSC 173943) exhibits antimicrobial activities against Bacillus subtilis and Pseudomonas aeruginosa, with MIC of 25-100 μg/mL. Altersolanol A exhibits no phytotoxicity to Taxus (at dose of 4 μg/μL)[1].

• HY-N1969

  3,3'-Di-O-methylellagic acid	Inhibitor
  3,3'-Di-O-methylellagic acid obtained from Euphorbia adenochlora selectively inhibits the formation of acid-fastness in mycobacteria without retardation of their growth. 3,3'-di-O-methylellagic acid as a hepatoprotective compound is apparently due to its antioxidative effect[1][2].

• HY-119375

  Syncytial Virus Inhibitor-1	Inhibitor
  Syncytial Virus Inhibitor-1 is a potent, orally bioavailable respiratory syncytial virus (RSV) fusion inhibitor with EC50s of 0.002 μM, 0.004 μM, and 0.002 μM for RSV Long, RSV A2, and RSV B strains, respectively[1].

• HY-W588257

  (+)-Thienamycin	Inhibitor
  (+)-Thienamycin is a potent broad-spectrum antibacterial and β-lactamase inhibitor that can be from Streptomyces cattleya[1].

• HY-N2192R

  Swertianolin (Standard)	Inhibitor
  Swertianolin (Standard) is the analytical standard of Swertianolin. This product is intended for research and analytical applications. Swertianolin, a xanthone isolated from Gentianella Acuta, inhibits acetylcholinesterase (AChE). Swertianolin also exhibits anti-HBV and anti-bacterial activity[1][2].

• HY-B0671R

  Vancomycin (Standard)	Inhibitor
  Vancomycin (Standard) is the analytical standard of Vancomycin. This product is intended for research and analytical applications. Vancomycin is an antibiotic for the treatment of bacterial infections.

• HY-B0633A

  Hyaluronic acid
  Hyaluronic acid (corn fermented) is a biopolymer composed of repeating units of disaccharides with various applications.

• HY-N0804

  Narirutin	Inhibitor	99.85%
  Narirutin, one of the active constituents isolated from citrus fruits, has antioxidant and anti-inflammatory activities. Narirutin is a shikimate kinase inhibitor with anti-tubercular potency[1][2].

• HY-N8470

  Steffimycin B
  Steffimycin B is an anthracycline bacterial metabolite originally isolated from Streptomyces. It binds to DNA, preferentially intercalating at sites containing cytosine and guanine.2 Steffimycin B is cytotoxic to MCF-7, KB, NCI-H187, and Vero cells (IC50s=3.5, 6.75, 3.28, and 10.5 μM, respectively). It is active against M. tuberculosis (MIC=5.2 nM), B. cereus (MIC=1.56 μg/mL), and P. falciparum (IC50=2.19 μM).

• HY-B0535AS

  Ethambutol-d4 dihydrochloride	Inhibitor
  Ethambutol-d4 dihydrochloride is deuterated labeled Ethambutol dihydrochloride (HY-B0535A). Ethambutol dihydrochloride is an antimycobacterial compound that prevents cell wall formation by inhibiting arabinosyltransferase activity.

• HY-N5142S1

  α-Terpineol-d6	Inhibitor
  α-Terpineol-d6 is deuterated labeled Pulegone (HY-N1500). Pulegone, the major chemical constituent of Nepeta catariaessential oil which is an aromatic herb, is one of avian repellents[1]. The molecular target for the repellent action of Pulegone in avian species is nociceptive TRP ankyrin 1 (TRPA1). Pulegone stimulates both TRPM8 and TRPA1 channel in chicken sensory neurons and suppresses the former but not the latter at high concentrations[2].

• HY-D1689

  Rf470DL
  Rf470DL is a rotor-fluorogenic D-amino acid (RfDAA). Rf470DL can be used for labeling bacteria (Ex=470 nm, Em=640 nm)[1].

• HY-161086

  Antibiofilm agent-4
  Antibiofilm agent-4 (compound 4p) is a LasR inhibitor. Antibiofilm agent-4 shows the best antibiofilm and anti-QS properties[1].

• HY-138023

  Leucomycin A4	Inhibitor
  Leucomycin A4 is a macrolide antibiotic that can be extracted from S. kitasatoensis. Leucomycin A4 inhibits a variety of bacteria, including S. aureus, B. subtilis, C. diphtheriae, N. gonorrhoeae, and H. influenzae (MICs = 0.15, 1.25, 0.15, 0.6, and 0.15 µg/ml, respectively)[1].

• HY-N11722

  Panduratin A	Inhibitor
  Panduratin A, a natural chalcone compound, is a PPAR-α/δ activator. Panduratin A induces apoptosis, and promotes cell cycle arrest at G0/G1 phase in multiple hematologic malignant cell lines. Panduratin A has anticancer, antioxidant, anti-inflammatory, antibacterial, and antibiofilm activities[1][2].

• HY-138050

  Nyasol	Inhibitor
  Nyasol ((-)-Nyasol) is an active compound that has antifungal, antibacterial, antileishmanial, hyaluronidase inhibition activities. Nyasol inhibits LTB4 binding to human neutrophils. Nyasol suppresses neuroinflammatory response through the inhibition of I-κB degradation in LPS (HY-D1056)-stimulated BV-2 microglial cells[1][2].

• HY-P10546

  Polyalanine peptide	Inhibitor
  Polyalanine peptide (pALA) is an antimicrobial peptide that targets biofilms and Gram-negative bacteria and is non-toxic to mammalian cells. Polyalanine peptide forms an α-helical conformation that effectively permeabilizes Gram-negative bacterial membranes, thereby inducing lethal cell leakage. Polyalanine peptide can be used in anti-infection research[1].

• HY-P2206

  Zelkovamycin
  Zelkovamycin is a cyclic peptide antibiotic originally isolated from Streptomyces. It inhibits growth of X. oryzae, P. oryzae, S. aureus, and A. laidlawii in a concentration-dependent manner when used at concentrations ranging from 0.01 to 300 μg/mL.

• HY-B1149A

  Bacampicillin hydrochloride	Inhibitor	99.94%
  Bacampicillin hydrochloride is a penicillin antibiotic, is a prodrug of ampicillin with improved oral bioavailability.

• HY-N0610S1

  trans-Cinnamic acid-d7		99.98%
  trans-Cinnamic acid-d7 is the deuterium labeled trans-Cinnamic acid[1]. trans-Cinnamic acid is a natural antimicrobial, with minimal inhibitory concentration (MIC) of 250 μg/mL against fish pathogen A. sobria, SY-AS1[2].

• HY-126637

  Marasmic acid	Inhibitor
  Marasmic acid is a sesquiterpenoid with unsaturated dialdehyde functionality, first isolated from the Basidiomycete Marasmus conigenus. Marasmic acid has antibacterial, antifungal, cytotoxic and mutagenic activities, and its broad-spectrum activity is related to the α,β-unsaturated aldehyde group. However, its detailed biological mechanism of action has not been clarified. Previous studies have suggested that marasmic acid may exert its effects by reacting with endogenous nucleophiles or forming pyrrole derivatives. This study found that marasmic acid interferes with the membrane sensor histidine kinase MoSln1p of M. oryzae, superactivates the HOG pathway and causes cell death, indicating that its mechanism of action is different from other unsaturated dialdehyde sesquiterpenoids.

• HY-NP016

  Brucella bacterial protein	Activator
  Brucella bacterial protein is native protein that purified from Brucella for life science related research[1].

• HY-N13149

  Tetromycin C1	Inhibitor
  Tetromycin C1 is an antibiotic bactericide isolated from Streptomyces sp.[1].

• HY-B0147R

  Pefloxacin (Standard)	Inhibitor
  4-(Trifluoromethoxy)aniline (Standard) is the analytical standard of 4-(Trifluoromethoxy)aniline. This product is intended for research and analytical applications. 4-(Trifluoromethoxy)aniline is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

• HY-N5173

  Aibellin	Inhibitor
  Aibellin, a peptide antibiotic, is a useful and potent modifier of rumen fermentation[1].

• HY-112240

  Antibacterial agent 104	Inhibitor
  Antibacterial agent 104 (Compound 7) is a potent antibacterial agent. Antibacterial agent 104 displays excellent antibacterial activity in vitro and good efficacy in vivo against MRSA[1].

• HY-19964

  Potassium clavulanate cellulose	Inhibitor
  Potassium clavulanate cellulose (Potassium clavulanate:cellulose (1:1)) is a mixture of potassium clavulanate and cellulose, is a bacterial β-lactamase inhibitor. Clavulanate potassium is a form of Clavulanic acid. Clavulanate potassium fights bacteria that resistant to penicillins and other antibiotics. Potassium clavulanate with the combination of amoxicillin can be used for the research of different infections caused by bacteria, such as sinusitis, pneumonia, ear infections, bronchitis, urinary tract infections, and infections of the skin[1][2].

• HY-115349

  Neamine tetrahydrochloride	Inhibitor	99.92%
  Neamine tetrahydrochloride, a degradation product of Neomycin, is a broad-spectrum aminoglycoside antibiotic. Neamine tetrahydrochloride is an anti-angiogenesis agent targeting angiogenin. Neamine tetrahydrochloride has potent antibacterial, antitumor and neuroprotective activities[1][2].

• HY-N8097

  Kushenol W	Inhibitor
  Kushenol W is a prenylated flavonoid that can be isolated from the root of Sophora flavescens. Kushenol W has antimicrobial effect, with a MIC of 10 μg/mL for Staphylococcus aureus[1].

• HY-143455

  Germination-IN-2	Inhibitor
  Germination-IN-2 (compound 15) is a potent germination inhibitor with an IC50 of 1.3 µM. Germination-IN-2 shows anti-germination activity with 3% germination rate[1].

• HY-N2579

  1-Kestose	Activator
  1-Kestose, the smallest fructooligosaccharide component, which efficiently stimulates Faecalibacterium prausnitzii as well as Bifidobacteria.

• HY-13735D

  d-Atabrine dihydrochloride	Inhibitor	99.64%
  d-Atabrine dihydrochloride is an active enantiomer of quinacrine which displays antiprion activity.

• HY-14855A

  (S)-Tedizolid	Inhibitor	98.21%
  (S)-Tedizolid is the S-enantiomer of Tedizolid. Tedizolid is a novel oxazolidinone with activity against Gram-positive pathogens. (S)-Tedizolid is the less active isomer.

• HY-111321

  Fuscin	Inhibitor
  Fuscin, a fungal metabolite, CCR5 receptor antagonist with anti-HIV effects. Fuscin is a respiration and oxidative phosphorylation inhibitor, and also a mitochondrial SH-dependent transport-linked functions inhibitor[1][2][3].

• HY-130511

  FCE 22250
  FCE 22250 is a 3-azinomethylrifamycin with long-term in vivo persistence and good oral absorption. FCE 22250 shows superior efficacy against a broad antimicrobial spectrum including mycobacteria[1].

• HY-P5545

  Lynronne-1	Inhibitor
  Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection[1].

• HY-125161

  MT0703	Inhibitor
  MT0703 is an aminothiazolyl glycyl cephalosporin with a 1,5-dihydroxy-4-pyridone-2-carbonyl group and has good anti-Pseudomonas activity.

• HY-B1480

  Ethoxzolamide	Inhibitor	99.85%
  Ethoxzolamide is a carbonic anhydrase inhibitor with Ki of 1 nM.

• HY-B1009

  Ethylenediaminetetraacetic acid trisodium salt	Inhibitor
  Ethylenediaminetetraacetic acid trisodium salt (EDTA trisodium salt; Trisodium EDTA) is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid trisodium salt has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid trisodium salt decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid trisodium salt can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-N2048

  2,2':5',2''-Terthiophene	Inhibitor
  2,2':5',2''-Terthiophene (α-Terthiophene) is an oligomer of the heterocycle thiophene. 2,2':5',2''-Terthiophene has been employed as building block for the organic semi-conductor polythiophene.

• HY-N12287

  Curcapicycloside	Inhibitor
  Curcapicycloside (Pilosidine), a norlignan glucoside, exhibits antibacterial activity against Escherichia coli[1].

• HY-N7252

  Daphnin	Inhibitor	99.83%
  Daphnin is one of the major coumarin bioactive components with antibacterial activity. Daphnin is isolated from the whole herb of Daphne odora (Thunb.), which is a folk medicine in China for the relief of fever[1][2].

• HY-163615

  Antimicrobial agent-32	Inhibitor
  Antimicrobial agent-32 (Compound 4g) is an antimicrobial agent that exhibits significant activity against various bacteria, including Staphylococcus aureus, Bacillus subtilis, Bacillus cereus (MIC=1000 µg/mL), Klebsiella pneumonia, and Staphylococcus aureus (MRSA) (MIC=500 µg/mL), as well as Escherichia coli (MIC=250 µg/mL). Additionally, Antimicrobial agent-32 inhibits the proliferation of MCF-7, HCT-116, and HepG-2 cells, demonstrating anticancer activity[1].

• HY-155530

  PEX5-PEX14 PPI-IN-1
  PEX5-PEX14 PPI-IN-1 (Compound 8) is a PEX14-PEX5 PPI inhibitor. PEX5-PEX14 PPI-IN-1 disrupts the PEX5-TbPEX14 PPI with a Ki of 53 μM. PEX5-PEX14 PPI-IN-1 inhibits the bloodstream form of T. b. brucei (EC50: 5 μM)[1].

• HY-N10414

  Primulic acid I	Inhibitor
  Primulic acid I (Primulasaponin 1) is a plant-derived triterpenoid saponin with one sugar chain (monodesmoid)[1].

• HY-P5720

  Peptide 5e	Inhibitor
  Peptide 5e is an antimicrobial peptide. Peptide 5e inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 5, 25 μg/mL respectively[1].

• HY-13756

  Tacrolimus	Inhibitor
  Tacrolimus (FK506), a macrocyclic lactone, binds to FK506 binding protein (FKBP) to form a complex. Tacrolimus inhibits calcineurin phosphatase, which inhibits T-lymphocyte signal transduction and IL-2 transcription. Immunosuppressive properties[1].

• HY-145415

  W13	Inhibitor
  W13 is a potent MsbA inhibitor. W13 is an ATPase stimulator with an EC50 of 5.5 µM[1].

• HY-117660

  Lincomycin
  Lincomycin, a lincosamide antibiotic, is an antimicrobial agent used for the research of Gram-positive bacteria infections[1].

• HY-B0147A

  Pefloxacin mesylate	Inhibitor	99.73%
  Pefloxacin mesylate is a an antibacterial agent and prevents bacterial DNA replication by inhibiting DNA gyrase (topoisomerse) Target: DNA gyrase Pefloxacin is a synthetic chemotherapeutic agent used to treat severe and life-threatening bacterial infections.

• HY-N12149

  Axinysone B	Inhibitor
  Axinysone B can be isolated from Laurencia similis. Axinysone B has antibacterial activity against Staphylococcus sp.[1].

• HY-N14042

  Arizonin B2	Inhibitor
  Arizonin B2 is a microbial metabolite with anti-Gram-positive bacterial activities[1].

• HY-P9929

  Bezlotoxumab	Inhibitor
  Bezlotoxumab is a human monoclonal antibody directed against C. difficile toxin B. Bezlotoxumab binds to C. difficile toxin B preventing intestinal epithelial damage and colitis[1].

• HY-P5628

  Termicin
  Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity[1].

• HY-111183

  Neocarzinostatin	Inhibitor
  Neocarzinostatin, a potent DNA-damaging, anti-tumor antibiotic, recognizes double-stranded DNA bulge and induces DNA double strand breaks (DSBs). Neocarzinostatin induces apoptosis. Neocarzinostatin has potential for EpCAM-positive cancers treatment [1][2].

• HY-W017162S

  DL-3-Phenyllactic acid-d3	Inhibitor
  DL-3-Phenyllactic acid-d3 is a deuterated labeled DL-3-Phenyllactic acid[1]. DL-3-Phenyllactic acid is a broad-spectrum antimicrobial compound.

• HY-N3241

  Mucrolidin	Inhibitor
  Mucrolidin is an eudesmane-type sesquiterpenoid isolated from aerial parts of homalomena occulta. Mucrolidin exhibits weak antibacterial activities when it compares to Rifampicin (HY-B0272)[1].

• HY-146060

  Antibacterial agent 100	Inhibitor
  Antibacterial agent 100 (Compound 7c) is an antibacterial and antifungal agent. Antibacterial agent 100 shows promising activity with MIC values of 4, 4 and 8 μg/mL against Staphylococcus aureus, Candida albicans and Cryptococcus neoformans, respectively[1].

• HY-P1934

  Cyclo(Phe-Pro)	Inhibitor	98.77%
  Cyclo(Phe-Pro) (Cyclo(phenylalanylprolyl)) is a quorum-sensing molecule of Vibrio vulnificus that specifically interacts with RIG-I, inhibiting RIG-I polyubiquitination, suppressing IRF-3 activation, and reducing type I interferon production. Cyclo(Phe-Pro) enhances susceptibility to HCV and influenza virus and also alleviates plant aluminum toxicity stress. The mechanism of Cyclo(Phe-Pro) involves the regulation of host immune signaling pathways, bacterial virulence gene expression, and plant antioxidant systems, making it a promising candidate for research in viral infections, bacterial virulence regulation, and agricultural stress resistance[1][2][3].

• HY-B0275C

  Oxytetracycline calcium	Inhibitor
  Oxytetracycline calcium is an antibiotic belonging to the tetracycline class. Oxytetracycline calcium potently inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline calcium is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline calcium also possesses anti-HSV-1 activity[1][2][3].

• HY-16115

  BPH-652	Inhibitor	98.97%
  BPH-652 is a S. aureus dehydrosqualene synthase (CrtM) inhibitor, with a Ki of 1.5 nM and an IC50 of 100-300 nM (S. aureus pigment formation)[1].

• HY-15398

  Vitamin D3
  Vitamin D3 (Cholecalciferol; Colecalciferol) is a naturally occuring form of vitamin D. Vitamin D3 induces cell differentiation and prevents proliferation of cancer cells.

• HY-W109754

  2',4'-Dihydroxylchalcone	Inhibitor	98.78%
  2',4'-Dihydroxychalcone, in combination with nalidixic acid (HY-B0398), exhibits synergistic effects against E. coli by reducing membrane permeability[1].

• HY-P0311A

  LAH4 TFA	Inhibitor	99.17%
  LAH4 TFA, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 TFA possesses high plasmid DNA delivery capacities. LAH4 TFA has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes[1][2][3].

• HY-121034

  Acaterin	Inhibitor
  Acaterin is a compound isolated from Pseudomonas. Its biosynthetic gene cluster has been identified, and related studies have proposed its biosynthetic pathway. Comparative transcriptomics has shown that its formation is related to the bacterial regulatory network.

• HY-P0324A

  Parasin I TFA	Inhibitor	99.80%
  Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity[1].

• HY-B1118A

  Secnidazole hemihydrate	Inhibitor
  Secnidazole (RP-14539) hemihydrate is an orally active azole antibiotic and a imidazole mitigator of Serratia marcescens virulence. Secnidazole hemihydrate, as an analog of acylhomoserine lactones, effectively inhibits QS resulting in the attenuation of Pseudomonas aeruginosa pathogenesis. Secnidazole hemihydrate has antimicrobial activity against many anaerobic Gram-negative and Gram-positive bacterial species in vitro. Secnidazole hemihydrate can be used for the research of various diseases, such as amoebiasis and giardiasis, and bacterial vaginitis[1][2][3].

• HY-131583

  MP265	Inhibitor	99.50%
  MP265 (4-Chlorobenzyl carbamimidothioate hydrochloride) is a structural analogue of A22 but is less toxic. MP265 is a MreB inhibitor[1].

• HY-N9971R

  Hentriacontane (Standard)	Inhibitor
  Hentriacontane (Standard) is the analytical standard of Hentriacontane. This product is intended for research and analytical applications. Hentriacontane is a long-chain alkane. Hentriacontane exerts anti-inflammatory effects by inhibiting the NF-κB pathway. Hentriacontane has anti-inflammatory, antitumor and antibacterial activities[1].

• HY-163107

  Antimycobacterial agent-7	Inhibitor
  Antimycobacterial agent-7 (compound 4) is a 1,2,4-triazole anti-tuberculosis agent (MIC: 2 μg/mL). Antimycobacterial agent-7 inhibits Mtb KatG and causes the accumulation of ROS in Mtb cells. ROS produces oxidative damage, leading to the death of Mtb[1].

• HY-76199R

  trans-4-Hydroxycyclohexanecarboxylic acid (Standard)	Inhibitor
  Phenethicillin (sodium) (Standard) is the analytical standard of Phenethicillin (sodium). This product is intended for research and analytical applications. Phenethicillin (α-Phenoxyethylpenicillin) sodium is a Penicillin, and has antimicrobial activity[1].

• HY-122307A

  Sulisatin disodium	Inhibitor
  Sulisatin (DAN-603) disodium is an anionic diarrhea-promoting compound. During oral administration, Sulisatin disodium is hydrolyzed to diphenolic derivatives by bacterial aryl sulfate sulfohydrolases in the colon[1].

• HY-133704

  Pyrrolnitrin	Inhibitor	99.76%
  Pyrrolnitrin is an antibiotic isolated from Pseudomonas pyrrocinia. Pyrrolnitrin shows a broad spectrum of antibiotic activity against fungi, yeast and gram-positive bacteria[1].

• HY-B0898R

  Ceftiofur (sodium) (Standard)	Inhibitor
  Ceftiofur (sodium) (Standard) is the analytical standard of Ceftiofur (sodium). This product is intended for research and analytical applications. Ceftiofurna sodium is a third-generation cephalosporin antibiotic approved for veterinary use.

• HY-108365

  Gamithromycin	Inhibitor	99.92%
  Gamithromycin is an antimicrobial agent which can inhibit the growth of MmmSC strains B237 and Tan8 with MICs of 0.00012 and 0.00006 μg/mL, respectively.

• HY-146458

  Antibacterial agent 102	Inhibitor
  Antibacterial agent 102 (compound 32) possesses potent in vitro and in vivo antibacterial activity, with MICs < 0.5 μg/mL in Staphylococcus aureus (S. aureus). Antibacterial agent 102 also moderately inhibits CYP3A4 with an IC50 value of 6.148 μM. Antibacterial agent 102 can reduce Methicillin-resistant Staphylococcus aureus (MRSA) load in thigh infected mice[1].

• HY-124199

  Cephalochromin	Inhibitor
  Cephalochromin is an antibiotic and an inhibitor for bacterial fatty acid synthase (FabI). Cephalochromin inhibits FabI of Staphylococcus aureus and Escherichia coli with IC50 of 1.9 and 1.8 μM. Cephalochromin inhibits gram-positive methicillin-resistant S. aureus (MRSA) and quinolone-resistant S. aureus (QRSA), with MIC of 2-8 µg/mL[1].

• HY-78542

  Deshydroxyethoxy ticagrelor	Inhibitor	98.84%
  Deshydroxyethoxy ticagrelor (AR-C124910) is a metabolite of Ticagrelor (HY-10064) with antimicrobial and antiplatelet activities against MRSA[1].

• HY-P10548

  Cyclic L27-11	Inhibitor
  Cyclic L27-11 is a cyclic peptide-like antibiotic with strong antibacterial activity against specific bacteria such as Pseudomonas sp. Cyclic L27-11 shows nanomolar antibacterial activity against Pseudomonas sp., especially Pseudomonas aeruginosa. Cyclic L27-11 interferes with the function of bacterial outer membrane protein LptD, preventing the normal transport of lipopolysaccharide (LPS), leading to the accumulation of membrane-like substances in bacterial cells, which in turn affects the survival of bacteria. Cyclic L27-11 can be used in the development of antibacterial agents[1].

• HY-132975

  PrDiAzK	Inhibitor
  PrDiAzK is a bifunctional amino acid. PrDiAzK can be site-selectively incorporated into proteins in both bacterial and mammalian cell culture. PrDiAzK can be used for proteome-wide incorporation via stochastic orthogonal recoding of translation (SORT)[1]. PrDiAzK is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-126490

  Phleomycin	Inhibitor
  Phleomycin is an anticancer glycopeptide antibiotic found in Streptomyces verticillus, which cause DNA cleavage. Phleomycin binds and intercalates DNA to damage the integrity of the double helix, which is similar to Bleomycin (HY-17565A)[1].

• HY-B1802C

  Tosufloxacin tosylate	Inhibitor
  Tosufloxacin (A-61827) tosylate is an orally active fluoroquinolone antibiotic. Tosufloxacin tosylate shows a broad spectrum of antibacterial activity against gram-positive and gram-negative bacteria[1][2].

• HY-P5585

  Dermaseptin-B4
  Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor[1].

• HY-157142

  Antibacterial agent 165	Inhibitor
  Antibacterial agent 165 (compound 3), a hydroxyquinoline derivative, is a potent bacterial inhibitor. Antibacterial agent 165 inhibits methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-156197

  Biotin-cholesterol
  Biotin-cholesterol is a biotinylated form of Cholesterol (HY-N0322). Biotin-cholesterol can be used in the synthesis of biotin-conjugated liposomes and micelles for drug delivery[1].

• HY-N0540

  Cynaroside	Inhibitor	99.19%
  Cynaroside (Luteolin 7-glucoside) is a flavonoid compound that exhibits anti-oxidative capabilities. Cynaroside is also a potent influenza RNA-dependent RNA polymerase inhibitor with an IC50 of 32 nM. Cynaroside also is a promising inhibitor for H2O2-induced apoptosis, has cytoprotection against oxidative stress-induced cardiovascular diseases. Cynaroside also has antibacterial, antifungal and anticancer activities, antioxidant and anti-inflammatory activities[1][3][4][5].

• HY-143482

  MMV688844	Inhibitor
  MMV688844 is a potent Mycobacterium abscessus (Mabs) DNA Gyrase inhibitor with an IC50 value of 2 μM. MMV688844 has bactericidal properties against Mabs bamboo with a MIC50 of 12 μM. MMV688844 can be used for researching anti-bacteria[1].

• HY-W014316R

  5-Bromo-5-nitro-1,3-dioxane (Standard)	Inhibitor
  5-Bromo-5-nitro-1,3-dioxane (Standard) is the analytical standard of 5-Bromo-5-nitro-1,3-dioxane. This product is intended for research and analytical applications. 5-Bromo-5-nitro-1,3-dioxane, an antimicrobial compound, is effective against Gram-positive and Gram-negative bacteria and fungi, including yeast. 5-Bromo-5-nitro-1,3-dioxane inhibits enzyme activity and subsequent inhibition of microbial growth by the oxidation of essential protein thiol[1].

• HY-W811579

  Bensuldazic acid	Inhibitor
  Bensuldazic acid (compound 4f) is a lipophilic 3,5-disubstituted tetrahydro-2H-1,3,5-thiadiazine-2-thione (THTT) derivative that can be used as a prodrug model. Bensuldazic acid has antifungal activity[1].

• HY-B0239R

  Chloramphenicol (Standard)	Inhibitor
  Chloramphenicol (Standard) is the analytical standard of Chloramphenicol. This product is intended for research and analytical applications. Chloramphenicol is an orally active, potent and broad-spectrum antibiotic. Chloramphenicol shows antibacterial activity. Chloramphenicol represses the oxygen-labile transcription factor and hypoxia inducible factor-1 alpha (HIF-1α) in hypoxic A549 and H1299 cells. Chloramphenicol suppresses the mRNA levels of vascular endothelial growth factor (VEGF) and glucose transporter 1, eventually decreasing VEGF release. Chloramphenicol can be used for anaerobic infections and lung cancer research[1][2][3].

• HY-106668

  Isepamicin
  Isepamicin (Sch 21420) is an aminoglycoside antibacterial. Isepamicin has better activity against strains producing type I 6'-acetyltransferase. Isepamicin’s antibacterial spectrum includes Enterobacteriaceae and staphylococci. Anaerobes, Neisseriaceae and streptococci are resistant. Isepamicin exhibits a strong concentration-dependent bactericidal effect, a long post-antibiotic effect (several hours) and induces adaptive resistance[1].

• HY-N10081

  Leucinostatin D	Inhibitor
  Leucinostatin D is a peptide antibiotic from Paecilomyces marquandii. Leucinostatin D shows biological activity against Gram-positive bacteria and several fungi.

• HY-B0644R

  Sucralfate (Standard)	Inhibitor
  Sucralfate (Standard) is the analytical standard of Sucralfate. This product is intended for research and analytical applications. Sucralfate (Sucrose octasulfate-aluminum complex) is a potent and orally active gastroprotectant with no systemic effects. Sucralfate inhibits peptic activity and binds to negatively charged subepithelial proteins exposed during mucosal injury, forming a viscous layer that protects the vascular bed and proliferative zone. Sucralfate is used for prevention and research of several gastrointestinal diseases in vivo[1][2].

• HY-108062

  BLI-489	Inhibitor
  BLI-489 is a beta-lactamase inhibitor. BLI-489 combined with Piperacillin (HY-B1923) inhibits infection caused by class A (including ultra-broad spectrum β-lactamase), Class C (AmpC) and Class D β-lactamase expressing pathogens[1].

• HY-N0711

  Carvacrol	Inhibitor	99.98%
  Carvacrol is an orally active monoterpenic phenol that can be extract from an abundant number of aromatic plants, including thyme and oregano, possessing antioxidant, antibacterial, antifungal, anticancer, anti-inflammatory, hepatoprotective, spasmolytic, and vasorelaxant properties. Carvacrol also causes cell cycle arrest in G0/G1, downregulates Notch-1, and Jagged-1, and induces apoptosis. Carvacrol is used in low concentrations as a food flavoring ingredient and preservative, as well as a fragrance ingredient in cosmetic formulations[1][2].

• HY-169108

  DprE1-IN-11	Inhibitor
  DprE1-IN-11 (compound 3) is an orally active DprE1 inhibitor with antituberculosis activity against MTB H37Rv and MDR-MTB strains (MIC <0.029-0.095 μM)[1].

• HY-128773

  MRL-494	Inhibitor
  MRL-494, an antibacterial agent, is a inhibitor of β-barrel assembly machine A (BamA) impervious to efflux and the outer membrane permeability barrier. MRL-494 can inhibits Gram-positive (MIC of 12.5 μM for Staphylococcus aureus COL) and Gram-negative (MIC of 25 μM for E. coli JCM158) bacterias[1].

• HY-17422S1

  Acyclovir-d4	Inhibitor	98.66%
  Acyclovir-d4 is the deuterium labeled Acyclovir. Acyclovir (Aciclovir) is a guanosine analogue and an orally active antiviral agent. Acyclovir inhibits HSV-1 (IC50 of 0.85 μM), HSV-2 (IC50 of 0.86 μM) and varicella-zoster virus. Acyclovir can be phosphorylated by viral thymidine kinase (TK), and Acyclovir triphosphate interferes with viral DNA polymerization through competitive inhibition with guanosine triphosphate and obligatory chain termination[1][2][3]. Acyclovir prevents bacterial infections during induction therapy for acute leukaemia[4].

• HY-121410

  Narasin	Inhibitor
  Narasin is a cationic ionophore antibiotic and coccidiostat agent. Narasin inhibits NF-κB signaling and induces tumor cells apoptosis. Narasin has antimicrobial, antiviral anticancer activity. Narasin inhibits tumor metastasis and growth of ERα‑positive breast cancer cells by inactivation of the TGF-β/SMAD3 and IL‑6/STAT3 signaling pathways[1][2][3].

• HY-B1275

  Cephalothin sodium	Inhibitor	99.33%
  Cephalothin sodium is a first-generation cephalosporin antibiotic with broad antibacterial activity and is effective against Gram-positive and Gram-negative bacteria.

• HY-148180

  Antimycobacterial agent-4	Inhibitor
  Antimycobacterial agent-4 is a 2-amino-4-(2-pyridyl) thiazole derivative, with antimycobacterial activity, antiplasmodial activity, and cytotoxicity on a mammalian cell line[1][2].

• HY-169811

  CPW-86-363	Inhibitor
  CPW-86-363 is a novel broad-spectrum cephalosporin with antibacterial activity[1].

• HY-B0919R

  Azaserine (Standard)	Inhibitor
  Bamethan (hemisulfate) (Standard) is the analytical standard of Bamethan (hemisulfate). This product is intended for research and analytical applications. Bamethan (DL-Bamethane) hemisulfate is a vasodilator that exhibits significant activity in enhancing blood flow and reducing vascular resistance. Bamethan hemisulfate plays a crucial role in the treatment of cardiovascular conditions by improving oxygen delivery to tissues. Bamethan hemisulfate also aids in the management of hypertension through its relaxing effects on blood vessels.

• HY-121661

  Antibacterial agent 201	Inhibitor
  Antibacterial agent 201 (Compound 3) is an antibacterial agent through disruption of membrane integrity. Antibacterial agent 201 inhibits proliferation of Staphylococcus aureus strain RN4220, methacillin-resistane S. aureus, Pseudomonas aeruginosa strain PA01 and Escherichia coli strain ANS1 with MIC99s of 2.0, 1, 8.1 and 2.2 μg/mL, respectively[1].

• HY-W653977

  Chlortetracycline-13C,d3 hydrochloride	Inhibitor
  Chlortetracycline-13C,d3 hydrochloride (7-Chlorotetracycline-13C,d3 hydrochloride) is the 13C- and deuterium labeled Chlortetracycline hydrochloride (HY-B1327). Chlortetracycline hydrochloride is an orally active, selective antibiotic, that inhibits methanogenic bacteria through inhibition of bacterial protein synthesis. Chlortetracycline hydrochloride is a specific and potent calcium ionophore antibiotic, that inhibits binding of aminoacyl-tRNA to ribosomes[1][2][3][4][5].

• HY-162595A

  BDM88855 hydrochloride	Inhibitor
  BDM88855 hydrochloride is an allosteric inhibitor for the homolog AcrB protein. BDM88855 hydrochloride can boost the antibacterial effect of a panel of antibiotics (eg: Oxacillin (HY-B0925A), Linezolid (HY-10394), Novobiocin (HY-B0425), etc.) on wild-type E. coli[1][2].

• HY-10373

  Trimetrexate	Inhibitor	99.22%
  Trimetrexate (CI-898) is an antibiotic, also a potent and orally active dihydrofolate reductase (DHFR) inhibitor, reducing the production of DNA and RNA precursors and leading to cell death, with IC50 values of 4.74 nM and 1.35 nM for human DHFR and Toxoplasma gondii DHFR. Trimetrexate can also inhibit the growth of various cancer cells. Trimetrexate can be used for researching Pneumocystis carinii pneumonia (PCP) and cancer[1][2][3][4][5].

• HY-B0275

  Oxytetracycline	Inhibitor	99.05%
  Oxytetracycline is an antibiotic belonging to the tetracycline class. Oxytetracycline potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline also possesses anti-HSV-1 activity[1][2][3].

• HY-W108875R

  Mupirocin (lithium) (Standard)	Inhibitor
  Mupirocin (lithium) (Standard) is the analytical standard of Mupirocin (lithium). This product is intended for research and analytical applications. Mupirocin (BRL-4910A) lithium is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin lithium apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2][3][4][5].

• HY-113054

  DL-Glyceraldehyde 3-phosphate	Inhibitor
  DL-Glyceraldehyde 3-phosphate is an intermediate in several metabolic pathways, including glycolysis and gluconeogenesis. DL-Glyceraldehyde 3-phosphate is a potent inhibitor of the growth of E. coli. DL-Glyceraldehyde 3-phosphate is a competitive inhibitor of the acyltransferase[1][2].

• HY-N9596

  Stigmasta-4,22-dien-3-one	Inhibitor	98.82%
  Stigmasta-4,22-dien-3-one is an antitubercular agent. Stigmasta-4,22-dien-3-one shows cytotoxicity against human HT1080 tumoral cell line with an IC50 of 0.3 mM[1][2].

• HY-100126R

  Tubercidin (Standard)	Inhibitor

• HY-136068R

  DCAP (Standard)	Inhibitor
  Diphenylcyclopropenone (Standard) is the analytical standard of Diphenylcyclopropenone. This product is intended for research and analytical applications. Diphenylcyclopropenone (Diphencyprone) is a topical immunomodulatory agent that can be used for alopecia areata research[1][2].

• HY-U00154R

  Cefuracetime (Standard)	Inhibitor

• HY-B0408AR

  Clindamycin (hydrochloride) (Standard)	Inhibitor
  Clindamycin (hydrochloride) (Standard) is the analytical standard of Clindamycin (hydrochloride). This product is intended for research and analytical applications. Clindamycin (hydrochloride) is a semisynthetic lincosamide antibiotic, which inhibits protein synthesis by acting on the 50S ribosomal.

• HY-145854

  GA-O-06	Inhibitor
  GA-O-06, a 18β-Glycyrrhetinic acid derivative, is a potent antimicrobial and anti-inflammatory agent. GA-O-06 exerts anti-inflammation through the inhibition of NO, pro-inflammatory cytokines and chemokines. GA-O-06 displays a high antimicrobial activity against Gram-positive bacteria[1].

• HY-B1907A

  Rifamycin	Inhibitor
  Rifamycin (Rifamycin SV) belongs to the family of ansamycin antibiotics and has been isolated from the fermentation of A. mediterranei or its mutants. Rifamycin displays a broad spectrum of antibiotic activity against Gram-positive and, to a lesser extent, Gram-negative bacteria[1].

• HY-B1948

  Diniconazole	Inhibitor	99.12%
  Diniconazole is a newly developed fungicide strongly inhibited lanosterol 14 alpha-demethylation catalyzed by a yeast cytochrome P-450.

• HY-149223

  FtsZ-IN-5	Inhibitor
  FtsZ-IN-5 is a potent FtsZ inhibitor, to promote FtsZ polymerization and inhibit GTPase activity of FtsZ. Thus, FtsZ-IN-5 inhibits bacterial division to lead to death of bacterial cells. FtsZ-IN-5 shows bactericidal activity with no significant tendency to trigger bacterial resistance as well as rapid bactericidal properties. And FtsZ-IN-5 shows low hemolytic activity and cytotoxicity to mammalian cells[1].

• HY-W013186

  Lansoprazole sulfide	Inhibitor	99.48%
  Lansoprazole sulfide is an active metabolite of Lansoprazole by cytochrome P450, possesses anti-cancer activity. Lansoprazole sulfide is an anti-tuberculous agent, with an IC50 of 0.59 µM for M. tb[1].

• HY-N13905

  Alliacol A	Inhibitor
  Alliacol A is an antibiotic shows weak antibacterial and antifungal activity. Alliacol A inhibits DNA synthesis in cells of the ascitic form of Ehrlich carcinoma[1].

• HY-B0125S1

  Ofloxacin-d8	Inhibitor
  Ofloxacin-d8 (Hoe-280-d8) is the deuterium labeled Ofloxacin. Ofloxacin (Hoe-280) is a fluoroquinolone whose primary mechanism of action is inhibition of bacterial DNA gyrase.

• HY-129487

  (E/Z)-MC4	Control
  (E/Z)-MC4 is an enantiomer of the antibacterial agent MC4, which has antibacterial activity against a group of Staphylococcus aureus strains including MRSA, and has no significant toxicity to mammalian cells[1].

• HY-10939

  (-)-15-Deoxyspergualin	Inhibitor
  (-)-15-Deoxyspergualin is a potent antitumor agent. (-)-15-Deoxyspergualin shows strong inhibition against mouse leukemia L-1210[1].

• HY-16561R

  Resveratrol (Standard)	Inhibitor	99.73%
  Resveratrol (Standard) is the analytical standard of Resveratrol. This product is intended for research and analytical applications. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator[1][2][3][4]. Resveratrol is a potent pregnane X receptor (PXR) inhibitor[5]. Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model[6]. Resveratrol increases production of NO in endothelial cells[7].

• HY-162174

  MBL-IN-2	Inhibitor
  MBL-IN-2 ((2R, 2R')-5αC) is an inhibitor of Metallo-β-lactamase (MBL) that can inhibit New Delhi Metallo-β-lactamase-1 (NDM-1) with an IC50 of 0.3 μM. MBL-IN-2 ((2R, 2R')-5αC) can be used for the study of resistance to β-lactam antibiotics[1].

• HY-P4211

  PSM-β	Inhibitor	99.59%
  PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties[1][2].

• HY-17647R

  Zoliflodacin (Standard)	Inhibitor
  Oxyphenonium (bromide) (Standard) is the analytical standard of Oxyphenonium (bromide). This product is intended for research and analytical applications. Oxyphenonium bromide is an antiacetylcholine compound. Oxyphenonium bromide is an antagonist of mAChR. Oxyphenonium bromide protects against the bronchial obstructive effects[1][2][3].

• HY-79635R

  Methyl indole-3-carboxylate (Standard)	Inhibitor
  Tiagabine (hydrochloride) (Standard) is the analytical standard of Tiagabine (hydrochloride). This product is intended for research and analytical applications. Tiagabine hydrochloride is a potent and selective GABA reuptake inhibitor, used as an anticonvulsant agent, with IC50s of 67, 446 and 182 nM for [3H]GABA uptake in Synaptosomes, Neurons and Glia, respectively[1].

• HY-B0141

  Estradiol		99.93%
  Estradiol (β-Estradiol) is a steroid hormone and the major female sex hormone. Estradiol can up-regulate the expression of neural markers of human endometrial stem cells (hEnSCs) and promote their neural differentiation. Estradiol can be used for the research of cancers, neurodegenerative diseases and neural tissue engineering[1][2].

• HY-116788

  Lipofermata	Inhibitor
  Lipofermata is a fatty acid transport protein 2 (FATP2) inhibitor. Lipofermata shows fatty acid transport inhibition with an IC50 of 4.84 μM in Caco-2 cells. Lipofermata, an analog of spiro-indoline-thadiazole, shows zinc-specific suppression of antibacterial activity. Lipofermata perturbs zinc homeostasis in E. coli K-12 with a MIC of 16 μM[1][2][3].

• HY-N0749

  Jatrorrhizine	Inhibitor
  Jatrorrhizine is an alkaloid isolated from Coptis chinensis with neuroprotective, antimicrobial, antiplasmodial and antioxidant activities[1]. Jatrorrhizine is a potent and orally active inhibitor of AChE (IC50=872 nM) over >115-fold selectivity for BuChE[2]. Jatrorrhizine reduces uptake of serotonin (5-HT) and norepinephrine (NE) via inhibition of uptake-2 transporters[3].

• HY-W013863S

  Djalonensone-d3
  Djalonensone-d3 is a deuterium labeled Djalonensone (HY-W013863). Djalonensone, isolated from the roots of Anthocleista djalonensis (Loganiaceae), is an important taxonomic marker of the plant species[1][2].

• HY-B1902S

  Diaveridine-d6
  Diaveridine-d6 (EGIS-5645-d6) is deuterium labeled Diaveridine. Diaveridine (EGIS-5645) is a dihydrofolate reductase (DHFR) inhibitor with a Ki of 11.5 nM for the wild type DHFR and also an antibacterial agent[1].

• HY-P0230

  Teixobactin	Inhibitor
  Teixobactin is a potent antibiotic. Teixobactin shows antibacterial activity for gram-negative bacteria. Teixobactin inhibits cell wall synthesis by binding to a highly conserved motif of lipid II and lipid III[1][2][3].

• HY-U00255

  BO3482	Inhibitor
  BO3482 has Antimicrobial activity and can inhibit the growth of methicillin-resistant Staphylococci (MRS) with an MIC90 of 6.25 mg/mL.

• HY-169745

  9,12,13-Trihydroxy-10-octadecenoic acid	Inhibitor
  9,12,13-Trihydroxy-10-octadecenoic acid is an antimicrobial agent[1].

• HY-139698

  GT-1
  GT-1 (LCB10-0200), a siderophore-linked cephalosporin, is effective against clinical isolates of P. aeruginosa, Klebsiella oxytoca, Proteus spp., Serratia marcescens, and Enterobacter aerogenes.

• HY-B1743R

  Puromycin (Standard)	Inhibitor

• HY-16468

  Squalamine	Inhibitor
  Squalamine (MSI-1256) is an aminosterol compound with broad-spectrum antiviral activity. Squalamine makes cells less conducive to certain viral replication by altering the electrostatic interactions in the inner membrane of host cells. Squalamine also has antibacterial and antitumor activities. Squalamine has broad-spectrum antibacterial activity against Gram-negative and Gram-positive bacteria, fungi and protozoa. Squalamine inhibits tumor-related angiogenesis and the growth of human breast cancer cells. Squalamine restores the function of enteric nervous system in Parkinson,s disease mouse models[1][2][3][4][5].

• HY-N6583

  Licoflavonol	Inhibitor
  Licoflavonol, a minor flavone from the roots of Glycyrrhiza uralensis, is an inhibitor of the Salmonella type III secretion system (T3SS)[1][2].

• HY-B1374S1

  Florfenicol-d3	Inhibitor	99.90%
  Florfenicol-d3 is the deuterium labeled Florfenicol. Florfenicol, a commonly used veterinary antibiotic, is currently indicated for bovine respiratory disease, and also used in aquaculture for the control of enteric septicemia in catfish. Florfenicol can induce early embryonic death in eggs, with an LC50 of 1.07 μg/g.

• HY-B0330S

  Levofloxacin-d8	Inhibitor	99.59%
  Levofloxacin-d8 is the deuterium labeled Levofloxacin. Levofloxacin, a synthetic fluoroquinolone, is an antibacterial agent that inhibits the supercoiling activity of bacterial DNA gyrase, halting DNA replication.

• HY-N4033

  Horminone	Inhibitor
  Horminone is an abietan diterpene quinone that can be isolated from Labiatae family. Horminone increases of alanine aminotransferase (ALT) and aspartate aminotransferase (AST) serum levels in vivo. Horminone inhibits the growth of Trypanosoma cruzi and shows antibacterial activity[1].

• HY-B0274

  Chlorprothixene	Inhibitor	99.61%
  Chlorprothixene is a dopamine and histamine receptors antagonist with Kis of 18 nM, 2.96 nM, 4.56 nM, 9 nM and 3.75 nM for hD1, hD2, hD3, hD5 and hH1 receptors, respectively. Antipsychotic activity[1].

• HY-163528

  Antibacterial agent 213	Inhibitor
  Antibacterial agent 213 (compound Thy3d) shows potent antimicrobial activity by disrupting the integrity of the membrane of bacterial, with the MIC of 0.5 μg/ml for Staphylococcus aureus (MRSA)[1].

• HY-A0133R

  Chlorphenesin (Standard)	Inhibitor
  Chlorphenesin (Standard) is the analytical standard of Chlorphenesin. This product is intended for research and analytical applications. Chlorphenesin is a reversible antigen-associated immunosuppressant. Chlorphenesin is an antibacterial and antifungal agent used in numerous eye care cosmetics[1].

• HY-N7104R

  Lactitol (Standard)
  Lactitol (Standard) is the analytical standard of Lactitol. This product is intended for research and analytical applications. Lactitol (D-Lactitol), a nonabsorbable disaccharide, has the potential for constipation research[1].

• HY-15597

  Salinomycin	Inhibitor
  Salinomycin (Procoxacin), a polyether potassium ionophore antibiotic, selectively inhibits the growth of gram-positive bacteria. Salinomycin is a potent inhibitor of Wnt/β-catenin signaling, blocks Wnt-induced LRP6 phosphorylation. Salinomycin (Procoxacin) shows selective activity against human cancer stem cells[1][2][3].

• HY-B0947S1

  Sulfanitran-13C6	Inhibitor
  Sulfanitran-13C6 is the 13C labeled Sulfanitran. Sulfanitran is an antibacterial and anticoccidial agent used in poultry feeds. Sulfanitran also is a multidrug resistance protein 2 (MRP2) stimulator that can increase the affinity of MRP2 for estradiol-17-β-D-glucuronide (E217βG).

• HY-16592

  Brefeldin A
  Brefeldin A (BFA) is a lactone antibiotic and a specific inhibitor of protein trafficking. Brefeldin A blocks the transport of secreted and membrane proteins from endoplasmic reticulum to Golgi apparatus[1][2]. Brefeldin A is also an autophagy and mitophagy inhibitor[3]. Brefeldin A is a CRISPR/Cas9 activator[5]. Brefeldin A inhibits HSV-1 and has anti-cancer activity[5].

• HY-B0474

  Tetracycline hydrochloride	Inhibitor
  Tetracycline (hydrochloride) is a broad-spectrum antibiotic, exhibiting activity against a wide range of gram-positive and gram-negative bacteria.

• HY-16745

  Lascufloxacin	Inhibitor	98.04%
  Lascufloxacin (KRP-AM1977X) is a potent and orally active fluoroquinolone antibacterial agent. Lascufloxacin potently inhibits infections caused by various pathogens, including quinolone-resistant strains. Lascufloxacin has the potential for various infectious diseases treatment, including lower respiratory tract infections[1][2].

• HY-W335896

  4-(2-Octylamino)diphenylamine	Inhibitor
  4-(2-Octylamino)diphenylamine is an aromatic amine antioxidant, which is toxic to V. fischeri with an IC50 value of 0.68 mg/mL. 4-(2-Octylamino)diphenylamine induces skin sensitization and contact dermatitis in a local lymph node assay in mice. 4-(2-Octylamino)diphenylamine can be used as an additive in rubber[1][2][3].

• HY-143249

  MtMetAP1-IN-1	Inhibitor
  MtMetAP1-IN-1 is an inhibitor of Mycobacterium tuberculosis (Mtb), targeting methionine aminopeptidase 1 (MetAP1). MtMetAP1-IN-1 exerts antimycobacterial activity[1].

• HY-N3960

  Glycyrin	Inhibitor
  Glycyrin is a PPAR-γ ligand of licorice. Glycyrin can decrease the blood glucose levels of genetically diabetic mice. Glycyrin also shows antibacterial activity[1][2][3].

• HY-17566

  Capreomycin sulfate	Inhibitor
  Capreomycin sulfate is a macrocyclic peptide antibiotic that inhibits phenylalanine synthesis in mycobacterial ribosomal translation. Capreomycin sulfate has anti-amyloidogenic and pro-fibrinolytic activities, reducing amyloid-induced cytotoxicity by inhibiting the occurrence of amyloid fibrillation. Capreomycin sulfate can be used in the study of multidrug-resistant tuberculosis, type 2 diabetes, Alzheimer's disease and Parkinson's disease[1][2][3][4][5].

• HY-128780

  Upleganan	Inhibitor
  Upleganan (SPR206), a polymyxin analogue, and shows antibiotic activity against multidrug resistant Gram-negative pathogen. The MIC values of Upleganan against Pseudomonas aeruginosa Pa14 and Acinetobacter baumannii NCTC13301 are both 0.125 mg/L[1][2].

• HY-B0026R

  Ceftiofur (hydrochloride) (Standard)	Inhibitor

• HY-B0129S

  Aztreonam-d6	Inhibitor	99.29%
  Aztreonam-d6 is deuterium labeled Aztreonam. Aztreonam (SQ-26,776) is a synthetic monocyclic beta-lactam antibiotic, which has a very high affinity for penicillin-binding protein 3 (PBP-3).

• HY-P4744

  LL-37 amide	Inhibitor
  LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research[1][2].

• HY-I0447R

  4-Aminosalicylic acid (Standard)	Inhibitor
  4-Aminosalicylic acid (Standard) is the analytical standard of 4-Aminosalicylic acid. This product is intended for research and analytical applications. 4-Aminosalicylic acid (ASA) is an orally active antibiotic and has the potential to treat tuberculosis[1].

• HY-B1366

  Meclocycline Sulfosalicylate Salt	Inhibitor	99.56%
  Meclocycline Sulfosalicylate Salt is a tetracycline antibiotic with broad-spectrum antibacterial activities, preventing skin bacterial infections such as acne vulgaris[1].

• HY-B0177

  Tinidazole	Inhibitor
  Tinidazole, an orally available antibacterial agent, is a 5-nitroimidazole with selective activity against anaerobic bacteria and protozoa[1].

• HY-P10564

  Pardaxin P 4	Inhibitor
  Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembrane perforator that can interact with phospholipid bilayers of different compositions and induce cytotoxicity and pore formation. Pardaxin P 4 can be used in the research of antimicrobial drugs[1].

• HY-139765

  Antibacterial agent 48	Inhibitor
  Antibacterial agent 48, an antibacterial agent, significantly lowers MIC value of antibacterial agent Ceftazidime[1].

• HY-14855

  Tedizolid	Inhibitor	99.03%
  Tedizolid (TR 700; Torezolid; DA-7157) is a novel oxazolidinone, acting through inhibition of bacterial protein synthesis by binding to 23S ribosomal RNA (rRNA) of the 50S subunit of the ribosome.

• HY-E70234

  Sortase A, S. aureus	Inhibitor
  Sortase A, S. aureus (SrtA), a transpeptidase enzyme is present in many Gram-positive bacteria and helps in the recruitment of the cell surface proteins. Sortase A, S. aureus plays an important part in ligation of various molecules on the cell surfaces[1].

• HY-126569

  Efrotomycin	Inhibitor
  Efrotomycin is an orally active antibiotic. Efrotomycin can be isolated from the Streptomyces Lactamdurans. Efrotomycin has insignificant effect on Salmonella typhimurium quantity, duration, shedding rate, and antimicrobial susceptibility in infected pigs[1][2].

• HY-149812

  AcrB-IN-4	Inhibitor
  Efflux pump-IN-4 is an AcrB efflux pump inhibitor, with ability to potentiate the effect of antibiotics. Efflux pump-IN-4 inhibits Nile Red (a known substrate of AcrB) efflux. Efflux pump-IN-4 does not disrupts the bacterial outer membrane nor display toxicity in a nematode model[1].

• HY-B0027

  Valnemulin hydrochloride	Inhibitor	98.03%
  Valnemulin hydrochloride is an orally effective truncated pleurotin antibiotic that inhibits protein synthesis in bacteria by binding to peptidyl transferase in the 50s ribosome subunit. Valnemulin hydrochloride effectively eliminates Mycobacterium bovis in the lungs in an experimental bovine model of Mycoplasma bovis infection. Valnemulin hydrochloride can reduce the mortality of epidemic rabbit enteropathy and has no adverse effect on the growth performance of rabbits[1][2].

• HY-N0163R

  Magnolol (Standard)	Inhibitor
  Magnolol (Standard) is the analytical standard of Magnolol. This product is intended for research and analytical applications. Magnolol, a natural lignan isolated from the stem bark of Magnolia officinalis, is a dual agonist of both RXRα and PPARγ, with EC50 values of 10.4 μM and 17.7 μM, respectively.

• HY-15141R

  Staurosporine (Standard)	Inhibitor

• HY-P99898

  Setoxaximab	Inhibitor
  Setoxaximab is an IgG1-κ humanized chimeric antibody targeting shiga toxin type 1[1].

• HY-12547

  Betonicine
  Betonicine (Achilleine), an alkaloid, has cell protectant activity. Betonicine protects Bacillus subtilis against extremes in osmolarity and growth temperatures[1].

• HY-129065

  Nourseothricin sulfate	Inhibitor
  Nourseothricin sulfate (Streptothricin sulfate) is a broad-spectrum antibiotic that destroys the outer membrane of Gram-negative bacteria and is a dominant selective marker for Fonsecaea pedrosoi[1][2]. Nourseothricin sulfate inhibits protein biosynthesis in prokaryotic cells and strongly inhibits the growth of eukaryotes like fungi and can also be used as a elective marker for a wide range of organisms including bacteria, yeast, filamentous fungi, and plant cells[3].

• HY-N0656

  Usnic acid	Inhibitor
  Usnic acid, a lichen-derived secondary metabolite, has a unique dibenzofuran skeleton. Usnic acid has excellent anticancer and antimicrobial properties. Usnic acid significantly inhibits RANKL-mediated osteoclast formation and function by reducing the transcriptional and translational expression of NFATc1[1].

• HY-Y1913

  Potassium tetraborate tetrahydrate, 99.5%	Inhibitor
  Potassium tetraborate tetrahydrate, 99.5% has antibacterial activity against Pectobacterium carotovorum. Potassium tetraborate tetrahydrate, 99.5% can be used as a biological material or organic compound for life science related research[1].

• HY-N8411R

  Aromadendrene (Standard)	Inhibitor
  Benzenesulphonamide (Standard) is the analytical standard of Benzenesulphonamide. This product is intended for research and analytical applications. Benzenesulphonamide (compound 1) is a potent carbonic anhydrase inhibitor. Benzenesulphonamide shows CA II inhibitory activity[1].

• HY-17025

  Rifabutin	Inhibitor	99.20%
  Rifabutin (Ansamycin) is a semisynthetic ansamycin antibiotic with potent antimycobacterial properties. Rifabutin inhibits DNA-dependent RNA polymerase.

• HY-130581

  Lipid X	Inhibitor
  Lipid X is a novel monosaccharide precursor of Lipid A (the active moiety of gram-negative endotoxin). Lipid X is protective against endotoxin administered to mice and sheep and against life-threatening gram-negative infections in mice[1].

• HY-N4247

  Kuwanon G	Inhibitor
  Kuwanon G is a flavonoid isolated from Morus alba, acts as a bombesin receptor antagonist, with potential antimicrobial activity[1][2].

• HY-W087988S

  3-Pentanol-d5
  3-Pentanol-d5 is the deuterium labeled 3-Pentanol[1]. 3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. 3-pentanol elicits plant immunity against microbial pathogens and an insect pest in crop plants[2].

• HY-B1729

  Phenoxyethanol	Inhibitor	99.49%
  Phenoxyethanol has a broad spectrum of antimicrobial agent. Phenoxyethanol is an uncouple agent in oxidative phosphorylation from respiration and competitively inhibits malate dehydrogenase. Phenoxyethanol is used as a preservative in cosmetic, vaccine, and textile, et al[1].

• HY-E70070

  Endo-β-N-acetylglucosaminidase (Endo A)	Inhibitor
  Endo-β-N-acetylglucosaminidase (Endo A) is an Endo-β-N-acetylglucosaminidases (ENGases) from Arthrobacter protophormiae. Endo-β-N-acetylglucosaminidase (Endo A) can transfer a high-mannose type oligosaccharide to monosaccharides such as N-acetylglucosamine (GlcNAc) and glucose to form a new oligosaccharide. Endo-β-N-acetylglucosaminidase (Endo A) catalyzes glycopeptide synthesis by using Man3GlcNAc-oxazoline[1].

• HY-B0083R

  Leflunomide (Standard)
  Leflunomide (Standard) is the analytical standard of Leflunomide. This product is intended for research and analytical applications. Leflunomide is a pyrimidine synthesis inhibitor, inhibiting dihydroorotate dehydrogenase (DHODH), and acts as a disease-modifying antirheumatic agent.

• HY-B0479S

  Thiamphenicol-d3	Inhibitor
  Thiamphenicol-d3 is a deuterium labeled Thiamphenicol. Thiamphenicol, a methyl-sulfonyl derivative of Chloramphenicol, is a broad-spectrum antimicrobial antibiotic. Thiamphenicol acts by binding to the 50S ribosomal subunit, leading to inhibition of protein synthesis and bacteriostatic effect (against Gram-negative, Gram-positive aerobic and anaerobic bacteria)[1][2].

• HY-12485

  TBA-354	Inhibitor	99.74%
  TBA-354 is a potent anti-tuberculosis compound; maintains activity against Mycobacterium tuberculosis H37Rv isogenic monoresistant strains.

• HY-149734

  MA220607	Inhibitor
  MA220607 is an antibacterial agent with low hemolytic toxicity and a dual-target mechanism of action (MOA). MA220607 promotes FtsZ protein polymerization, also increases the permeability of bacterial membranes and inhibits biofilm formation. The resistance rate of MA220607 is low, and the MICs against Gram-positive bacteria and Gram-negative bacteria are Table 0.062-2 μg/mL and 0.5-4 μg/mL, respectively)[1].

• HY-115770

  8-Methylsulfinyloctyl isothiocyanate		99.36%
  8-Methylsulfinyloctyl isothiocyanate, an isothiocyanate, has antimicrobial activity and remarkable inhibitory activity against plant growth[1]. 8-Methylsulfinyloctyl isothiocyanate impair COX-2 mediated inflammatory responses in LPS stimulated raw macrophages[2].

• HY-W099689

  3-Octanol	Inhibitor	98.81%
  3-Octanol is a fragrance ingredient. 3-octanol not to be persistent, bioaccumulative, and toxic[1].

• HY-77036

  Furagin	Inhibitor	99.84%
  Furagin (Furazidine), an analogue of Nitrofurantoin (HY-A0090), is an antibiotic with antibacterial activity against ESKAPE pathogens with MIC values of 0-32 µg/mL. Furagin inhibits human Carbonic anhydrases . Furagin is promising for research of cancer and urinary tract infections (UTIs)[1][2][3][4][5].

• HY-P5724

  Nv-CATH	Inhibitor
  Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality[1].

• HY-W017316

  Terpinen-4-ol
  Terpinen-4-ol (4-Carvomenthenol) is a naturally occurring monoterpene, and can be extracted from a variety of aromatic plants. Terpinen-4-ol is a potent bactericidal agent which possess antifungal , anti-inflammatory and antitumor properties as well, suggesting Terpinen-4-ol to be used for relevant research[1][2].

• HY-B1145S

  Chlorhexidine-d8 dihydrochloride	Inhibitor
  Chlorhexidine-d8 (dihydrochloride) is the deuterium labeled Chlorhexidine dihydrochloride. Chlorhexidine dihydrochloride is an antibacterial, used as an antiseptic and for other applications.

• HY-146104

  Antimycobacterial agent-1	Inhibitor
  Antimycobacterial agent-1 (compound 33) has selectively antimycobacterial activity against Mycobacterium tuberculosis (M. tuberculosis) H37Ra with a MIC value of 1 μg/ml. Antimycobacterial agent-1 has relatively low cytotoxicity in normal cells (Vero cells IC50 = 143.2 μg/ml)[1].

• HY-N0644R

  Carnosic acid (Standard)	Inhibitor
  Carnosic acid (Standard) is the analytical standard of Carnosic acid. This product is intended for research and analytical applications. Carnosic acid has demonstrated inhibition of oxidative stress and inflammation, suppression of cell proliferation, and antibacterial activity[1].

• HY-N1103A

  Vasicine hydrochloride	Inhibitor
  Vasicine hydrochloride (peganine hydrochloride) is a quinazoline alkaloid isolated from Justicia adhatoda. Vasicine (peganine) possesses anti- tuberculosis activity[1].

• HY-17442

  Azathramycin	Inhibitor
  Azathramycin (Azaerythromycin A) is an antibiotic that targets ribosomes and possesses antibacterial activity, which can be used in research related to infectious diseases[1].

• HY-Y0682

  Ethylenediaminetetraacetic acid	Inhibitor
  Ethylenediaminetetraacetic acid (EDTA) is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-146047

  Antibacterial agent 94	Inhibitor
  Antibacterial agent 94 (compound 5b) is a potent antibacterial agent. Antibacterial agent 94 show antibacterial activities and show the capability of eradicating MRSA persisters. Antibacterial agent 94 has an effect on bacterial membrane. Antibacterial agent 94 interferes in phosphatidylglycerol (PG) synthesis pathway[1].

• HY-134635

  Dehydrozingerone	Inhibitor	99.98%
  Dehydrozingerone (Compound 10), a structural half analogue of Curcumin (HY-N0005), is a phenolic compound with antibacterial, anticancer, antioxidant, anti-Alzheimer’s and antifungal activity, which is isolated from ginger (Zingiber officinale) rhizomes. Dehydrozingerone shows moderate inhibitory activities on the secretion of HBsAg in HepG 2 cells with an IC50 value of 0.50 mM[1][2][3].

• HY-W011522R

  Taurolidine (Standard)	Inhibitor

• HY-117840

  Altromycin F	Inhibitor
  Altromycin F is an anthraquinone-derived antibiotic produced by the actinomycete AB 1246E-26 isolated from a South African bush soil. Altromycin F has antibacterial activity against Gram-positive bacteria, particularly Streptococcus and Staphylococcus, with a microbial inhibitory concentration (MIC) ranging from 0.2-3.12 μg/mL[1].

• HY-N0644

  Carnosic acid	Inhibitor	99.15%
  Carnosic acid is an orally active lipid absorption inhibitor. Carnosic acid has demonstrated inhibition of oxidative stress and inflammation, suppression of cell proliferation, and antibacterial activity.

• HY-15662S

  Tulathromycin A-d7	Inhibitor
  Tulathromycin A-d7 (Tulathromycin-d7) is deuterium labeled Tulathromycin A. Tulathromycin A (Tulathromycin), a macrolide antibiotic, inhibits protein synthesis (IC50=0.26 μM) by targeting bacterial ribosome. Tulathromycin A is used for the research of respiratory disease in cattle and swine. Immunomodulatory effects[1][2][3][4].

• HY-129405R

  N-(Ketocaproyl)-DL-homoserine lactone (Standard)	Inhibitor
  N-(Ketocaproyl)-DL-homoserine lactone (Standard) is the analytical standard of N-(Ketocaproyl)-DL-homoserine lactone. This product is intended for research and analytical applications. N-(Ketocaproyl)-DL-homoserine lactone is a natural, very active ligand of LuxR. N-(Ketocaproyl)-DL-homoserine lactone is a quorum sensing (QS) autoinducer[1].

• HY-19806

  Ceftolozane
  Ceftolozane (CXA-101 free base; FR264205 free base) is a cephalosporin antibiotic with potent activity againstPseudomonas aeruginosa and strains Enterobacteriaceae, with MICs of 0.5 and 0.25-0.5 mg/L[1].

• HY-N6727

  Gliotoxin	Inhibitor
  Gliotoxin is a secondary metabolite, the most abundant mycotoxin secreted by A. fumigatus, inhibits the phagocytosis of macrophages and the immune functions of other immune cells [1]. Gliotoxin inhibits inducible NF-κB activity by preventing IκB degradation, which consequently induces host-cell apoptosis[2]. Gliotoxin activates PKA and increases intracellular cAMP concentration; modulates actin cytoskeleton rearrangement to facilitate A. fumigatus internalization into lung epithelial cells[3]. Gliotoxin is a potent NOTCH2 transactivation inhibitor, can effectively induce apoptosis of chronic lymphocytic leukemia (CLL) cells[4].

• HY-114622

  AFN-1252 tosylate	Inhibitor
  AFN-1252 (API-1252) tosylate is an orally active and selective inhibitor of FabI, an essential enzyme in fatty acid biosynthesis in Staphylococcus spp. AFN-1252 tosylate exhibits exquisite and highly selective activity against Staphylococcus spp. AFN-1252 tosylate exhibits typical MIC90 values of ?0.015 μg/ml against diverse clinical isolates of S. aureus. AFN-1252 tosylate is efficacious in a mouse model of septicemia providing 100% protection from an otherwise lethal peritoneal infection of S. aureus Smith[1][2].

• HY-153351

  IpOHA	Inhibitor	98.58%
  IpOHA is a potent plant KARI inhibitor. IpOHA also is an antimycobacterial agent with a Ki value of 97.7 nM for Mycobacterium tuberculosis (Mt)[1].

• HY-168042

  Antibacterial agent 243	Inhibitor
  Antibacterial agent 243 is an antibacterial agent, with EC50 values of 0.64 mg/L for Valsa mali, 26 mg/L for allicin, and 0.33 mg/L for tebuconazole. Antibacterial agent 243 can induce hyphal shrinkage and collapse, trigger the accumulation of reactive oxygen species inside cells, regulate antioxidant enzyme activity, initiate lipid peroxidation, and ultimately cause irreversible oxidative damage to Valsa mali cells[1].

• HY-116541R

  Acibenzolar-S-methyl (Standard)	Inhibitor
  Acibenzolar-S-methyl (Standard) is the analytical standard of Acibenzolar-S-methyl. This product is intended for research and analytical applications. Acibenzolar-S-methyl (ASM) is a plant resistance inducer that mimics pathogen-host interactions and leads to systemic acquired resistance in plants. Acibenzolar-S-methyl helps reduce the use of pesticides and can be used in research to prevent plant diseases[1][2].

• HY-17442R

  Azathramycin (Standard)	Inhibitor
  Azathramycin (Standard) is the analytical standard of Azathramycin. This product is intended for research and analytical applications. Azathramycin (Azaerythromycin A) is an antibiotic that targets ribosomes and possesses antibacterial activity, which can be used in research related to infectious diseases[1].

• HY-N15266

  Mukonidine	Inhibitor
  Mukonidine is a carbazole alkaloid with antibacterial activity[1].

• HY-127146

  Platensimycin	Inhibitor
  Platensimycin is an antibiotic produced by S. platensis that inhibits gram-positive bacteria by selectively inhibiting cellular lipid biosynthesis (IC50=0.1 μM). Platensimycin targets the β-ketoacyl-acyl-carrier-protein synthase I/II, FabF/B, an enzyme that participates in the biosynthesis of fatty acids (IC50s=48 nM and 160 nM for S.aureus and E.coli enzymes, respectively). Platensimycin is a promising agent for overcoming antibiotic resistance.

• HY-13434A

  Ionomycin calcium	Inhibitor
  Ionomycin calcium (SQ23377 calcium) is a potent, selective calcium ionophore and an antibiotic produced by Streptomyces conglobatus. Ionomycin calcium (SQ23377 calcium) is highly specific for divalent cations (Ca>Mg>Sr=Ba). Ionomycin (SQ23377) promotes apoptosis. Ionomycin calcium (SQ23377 calcium) also induces the activation of protein kinase C (PKC)[1][2][3].

• HY-125654A

  Olanexidine hydrochloride	Inhibitor
  Olanexidine hydrochloride is a monobiguanide compound with bactericidal activity. Olanexidine probably binds to the cell membrane, destroys membrane integrity. Olanexidine hydrochloride is active against a wide range of bacteria, including Gram-positive and Gram-negative bacteria. Olanexidine exhibits the bactericidal concentration of 109 μg/mL for Gram-positive bacilli[1].

• HY-17504

  Rosuvastatin Calcium		99.77%
  Rosuvastatin Calcium is a competitive HMG-CoA reductase (HMGCR) inhibitor, with an IC50 of 11 nM. Rosuvastatin Calcium potently blocks hERG current with an IC50 of 195 nM[2]. Rosuvastatin Calcium reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin Calcium effectively lowers low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels[1][2][3].

• HY-P5459

  Elafin(human)	Inhibitor
  Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus[1][2][3].

• HY-B0126S

  Marbofloxacin-d8	Inhibitor
  Marbofloxacin-d8 is the deuterium labeled Marbofloxacin. Marbofloxacin is a third generation fluoroquinolone and orally active antimicrobial agent, which has a broad spectrum bactericidal activity and good efficacy. Marbofloxacin can be used for the research of infections by Gram-positive and Gram-negative bacteria and Mycoplasma[1][2][3].

• HY-B1156R

  Cephradine (Standard)	Inhibitor
  Cephradine (Standard) is the analytical standard of Cephradine. This product is intended for research and analytical applications. Cephradine (Cefradine) is a broad-spectrum and orally active cephalosporin. Cephradine is active against both gram-positive and gram-negative pathogens. Cephradine is effective in eradicating most penicillinase-producing organisms. Cephradine has been used in the research of genitourinary, gastrointestinal and respiratory tract infections, and in infections of the skin and soft tissues. Cephradine blocks solar-ultraviolet induced skin inflammation through direct inhibition of TOPK[1][2][3].

• HY-B1464R

  Cetylpyridinium (chloride) (Standard)	Inhibitor
  Cetylpyridinium (chloride) (Standard) is the analytical standard of Cetylpyridinium (chloride). This product is intended for research and analytical applications. Cetylpyridinium chloride, a cationic quaternary ammonium compound, is an anti-bacterial agent with broad-spectrum activity. Cetylpyridinium chloride is an effective anti-HBV capsid assembly inhibitor with an IC50 of 2.5 μM. Cetylpyridinium chloride is used in pesticides and various types of mouthwashes, and other personal care products[1][2].

• HY-B1327A

  Chlortetracycline	Inhibitor
  Chlortetracycline (7-Chlorotetracycline) is an orally active, effective and selectively methanogenic bacteria inhibitor with bactericidal effects. Chlortetracycline is also a antibiotic that acts by inhibiting bacterial protein synthesis. Additionally, Chlortetracycline is a specific and potent calcium ionophore antibiotic, inhibiting binding of aminoacyl-tRNA to ribosomes[1][2][3][4].

• HY-173080

  Antibacterial agent 267	Inhibitor
  Antibacterial agent 267 (Compound h19) is a pleuromutilin derivative with a potent antibacterial activity on Gram-positive bacteria. Antibacterial agent 267 shows an antibacterial activity in methicillin-resistant Staphylococcus aureus (MRSA)-infected mouse models[1].

• HY-148111

  Antitubercular agent-33	Inhibitor
  Antitubercular agent-33 is a 2-aminothiazole derivative, shows potent antintubercular activity against Mycobacterium tuberculosis (Mtb)[1].

• HY-D1460

  Fluorescein Di-β-D-Glucuronide
  Fluorescein Di-β-D-Glucuronide, a fluorescent probe, can be utilized to non-invasively image the intestinal bacterial β-glucuronidase activity in nude mice. Fluorescein Di-β-D-Glucuronide-based imaging reveals the in vitro and in vivo activity of intestinal bacterial β-glucuronidase, which would facilitate pharmacodynamic studies of specific bacterial β-glucuronidase inhibitors in animal studies[1].

• HY-45854

  GWP-042	Inhibitor
  GWP-042 is a potent inhibitor of mycobacterial alanine dehydrogenase (Ald) Rv2780, with the IC50 of 0.21 μM. GWP-042 has antimicrobial activity against M. tuberculosis infection in vivo[1].

• HY-139982

  OX11	Inhibitor
  OX11 is a selective inhibitor of S. pneumoniae, P. aeruginosa, and E. coli bacterial strains[1].

• HY-168852

  Antimicrobial agent-37	Inhibitor
  Antimicrobial agent-37 (compound 6a) is a potent broad-spectrum antimicrobial agent that has a biofilm-destroying effect, acting on bacterial membranes and cracking them[1].

• HY-149349

  MtUng-IN-1
  MtUng-IN-1 (Compound 18a) is a Uracil DNA glycosylase of Mycobacterium (MtUng) inhibitor (IC50: 300 μM). MtUng-IN-1 can be used for research of cancers and infectious diseases[1].

• HY-163404

  Urease-IN-13	Inhibitor
  Urease-IN-13 (compound d8) is an inhibitor of urease with an IC50 value of 1.21 μM. Urease-IN-13 can be used in the study of infectious gastritis and gastric ulcer[1].

• HY-B0220A

  Erythromycin lactobionate	Inhibitor
  Erythromycin lactobionate is a macrolide antibiotic produced by actinomycete?Streptomyces erythreus?with a broad spectrum of antimicrobial activity. Erythromycin lactobionate binds to bacterial 50S ribosomal subunits and inhibits?RNA-dependent protein synthesis?by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid[1][2]. Erythromycin lactobionate also exhibits antitumor and neuroprotective effect in different fields of research[3][4].

• HY-P2020

  Berninamycin A
  Berninamycin A is a cyclic thiopeptide antibiotic first isolated from S. bernensis. It inhibits protein biosynthesis in Gram positive bacteria through binding with ribosomal subunits. Cyclic thiopeptide antibiotics, including berninamycin A, induce the transcriptional activator TipA in Streptomyces.

• HY-W015026R

  Isobutylparaben (Standard)	Inhibitor
  Isobutylparaben (Standard) is the analytical standard of Isobutylparaben. This product is intended for research and analytical applications. Isobutylparaben (Isobutyl 4-hydroxybenzoate) is a constitutive androstane receptor (CAR) activator. Isobutylparaben has a broad-spectrum antimicrobial activity and widely used in personal care products and cosmetics[1].

• HY-N10281

  Asperglaucin B	Inhibitor
  Asperglaucin B is an alkylated salicylaldehyde derivative from the fungus Aspergillus chevalieri SQ-8, with antibacterial activities. Asperglaucin B displays potent antibacterial activities against two plant pathogens Pseudomonas syringae pv actinidae (Psa) and Bacillus cereus, with an MIC value of 6.25 μM[1].

• HY-124879

  MF 961	Inhibitor
  MF 961 is a quinolone biocide. The MIC50 values ​of MF 961 against E. coli, Klebsiella sp., Enterobacter sp., Citrobacter sp., Citrobacter sp., and Shlgella sp. are all in the range of 0-25 mg/L[1].

• HY-B0273

  Sulfadiazine	Inhibitor	99.93%
  Sulfadiazine is a sulfonamide?antibiotic with antimalarial activity. Sulfadiazine can be used for toxoplasmosis research[1][2].

• HY-146348

  Tuberculosis inhibitor 5	Inhibitor
  Tuberculosis inhibitor 5 (Compound 11i) is a potent antimycobacterial biphenyl analogue without noticeable cytotoxicity. Tuberculosis inhibitor 5 is an anti-tuberculosis agent[1].

• HY-Y0366

  Lauric acid	Inhibitor	99.98%
  Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively[1].

• HY-N7047

  8-Epidiosbulbin E acetate	Inhibitor	98.42%
  8-Epidiosbulbin E acetate, a furanoid, is abundant in Dioscorea bulbifera L.. 8-Epidiosbulbin E acetate exhibits broad-spectrum plasmid-curing activity against multidrug-resistant (MDR) bacteria. 8-Epidiosbulbin E acetate induces liver injury in mice[1][2].

• HY-W003467

  Rabeprazole Sulfide	Inhibitor	98.09%
  Rabeprazole Sulfide is an active metabolite of Rabeprazole. Rabeprazole is a proton pump inhibitor that suppresses gastric acid secretion through an interaction with (H+/K+)-ATPase in gastric parietal cells. Rabeprazole markedly inhibits the motility of H. pylori. Rabeprazole has the potential for various peptic diseases treatment[1][2].

• HY-B0609

  Fosfomycin tromethamine	Inhibitor	99.69%
  Fosfomycin (MK-0955) tromethamine is a blood-brain barrier penetrating, broad-spectrum antibiotic by irreversibly inhibiting an early stage in cell wall synthesis. Fosfomycin tromethamine shows both in vivo and in vitro activity against a wide range of bacteria, including multidrug-resistant (MDR), extensively drug-resistant (XDR), and pan-drug-resistant (PDR) bacteria[1][2].

• HY-128866A

  (Rac)-TBAJ-876		99.54%
  (Rac)-TBAJ-876 is a racemate of TBAJ-876. TBAJ-876 is the inhibitor of mycobacterium tuberculosis. TBAJ-876 is the analogue of the anti-tuberculosis agent Bedaquiline (HY-14881). TBAJ-876 has the potential for the research of tuberculosis[1].

• HY-B1864AR

  Kasugamycin (hydrochloride) (Standard)	Inhibitor
  Kasugamycin (hydrochloride) (Standard) is the analytical standard of Kasugamycin (hydrochloride). This product is intended for research and analytical applications. Kasugamycin hydrochloride (Ksg hydrochloride) is an antibiotic which binds both the 30S and 70S ribosome but not isolated 50S subunits. Kasugamycin hydrochloride (Ksg hydrochloride) mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation[1][2].

• HY-B1252R

  Cefalonium (Standard)	Inhibitor
  Cefalonium (Standard) is the analytical standard of Cefalonium. This product is intended for research and analytical applications. Cefalonium is the first-generation β-lactam cephalosporin antibiotic that is widely used to research bovine mastitis caused by Gram-positive bacteria including staphylococci[1][2][3].

• HY-W773487

  FtsZ-IN-10	Inhibitor
  FtsZ-IN-10 is a bacterial division inhibitor that interferes with the normal assembly of FtsZ. FtsZ-IN-10 specifically binds to Bacillus subtilis FtsZ monomers, thereby affecting their polymerization behavior. FtsZ-IN-10 may also activate nucleotide-free archaeal FtsZ to form ordered polymers. FtsZ-IN-10 can hinder the localization of FtsZ in the Z ring and inhibit bacterial cell division. Chlorinated analogs of FtsZ-IN-10 show the ability to inhibit the growth of antibiotic-resistant clinical isolates such as Staphylococcus aureus and Enterococci[1].

• HY-105048A

  Omiganan pentahydrochloride	Inhibitor
  Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial profile. Omiganan pentahydrochloride is capable of inhibiting a variety of bacteria, including yeast, and is active against both gram-positive and gram-negative bacteria. Omiganan pentahydrochloride is able to interact with the bacterial cell membrane, causing the destruction of the cell membrane and the death of the bacteria. Omiganan pentahydrochloride can be used for the study of antimicrobial activity against pathogens commonly associated with catheter-associated infections, including strains with drug-resistant phenotypes[1].

• HY-B0308R

  Sparfloxacin (Standard)	Inhibitor
  Sparfloxacin (Standard) is the analytical standard of Sparfloxacin. This product is intended for research and analytical applications. Sparfloxacin (CI-978) is a fluoroquinolone antibiotic, shows broad and potent antibacterial activity[1].

• HY-107775

  Ganfeborole hydrochloride	Inhibitor	99.97%
  Ganfeborole hydrochloride (GSK656) is a potent antitubercular agent, acting as an inhibitor of Mycobacterium tuberculosis (Mtb) leucyl-tRNA synthetase (LeuRS), with an IC50 of 0.2 μM.

• HY-163517

  Antibacterial agent 211	Inhibitor
  Antibacterial agent 211 (compound k15) has bactericidal activity against clinically isolated MRSA and VRE (MICs = 0.25–1.00 μg/mL). Antibacterial agent 211 avoids resistance by damaging biofilm and targeting cell membranes[1].

• HY-128730

  Acetyl phosphate lithium potassium
  Acetyl phosphate lithium potassium is an endogenous metabolic product. Acetyl phosphate lithium potassium is a key substance in bacterial metabolic regulation, particularly in Lysine acetylation, and plays an important role in bacterial responses to environmental stress and adaptive reactions[1][2].

• HY-U00092

  BAY-Y 3118	Inhibitor	99.22%
  BAY-Y 3118 is a new chlorofluoroquinolone with antimicrobial activity.

• HY-N10307

  Anserinone B	Inhibitor
  Anserinone B is an antifungal and antibacterial benzoquinone. Anserinone B causes radial growth reductions of 50% and 37% against S.fimicola and A. furfuraceus, respectively. Anserinones B also displays moderate cytotoxicity in the NCI’s 60 human tumor cell line panel (GI50=4.4 µg/mL)[1].

• HY-144723

  Antitubercular agent-13	Inhibitor
  Antitubercular agent-13 (Compound 3d) is an antitubercular agent with MIC values of 0.007 µg/mL and 1.851 µg/mL against MTB H37Rv and MDR-MTB 16833, respectively. Antitubercular agent-13 shows metabolic instability[1].

• HY-W039454

  2,4-Dichlorobenzyl alcohol	Inhibitor	99.40%
  2,4-Dichlorobenzyl alcohol is a mild antiseptic, with a broad spectrum for bacterial and virus associated with mouth and throat infections[1].

• HY-B0960S

  Sulfabenzamide-d4
  Sulfabenzamide-d4 is the deuterium labeled Thiabendazole.

• HY-B0101B

  Fluconazole mesylate
  Fluconazole (mesylate) is a triazole antifungal drug used in the treatment and prevention of superficial and systemic fungal infections.

• HY-N8431

  5-Geranoxy-7-methoxycoumarin	Inhibitor
  5-Geranoxy-7-methoxycoumarin is a coumarin with anti-cancer, antifungal, and ?antibacterial?activities. 5-Geranoxy-7-methoxycoumarin induces cell apoptosis[1][2].

• HY-170747

  9-tert-Butyldoxycycline	Inhibitor
  9-tert-Butyldoxycycline exhibits immunomodulatory activity, alters the polarization states polymorphonuclear neutrophils, and ameliorates the inflammatory response in ischemia-reperfusion injury model. 9-tert-Butyldoxycycline is the ligand for ‘Tet-On’ switch system[1][2].

• HY-N0084

  Betulinaldehyde	Inhibitor
  Betulinaldehyde (Betunal) Has anti-cancer and anti-staphylococcus aureus activity. Betulinaldehyde Suppressible Akt, MAPK sum STAT3 Signal path, increase self-transfer, Suppression A549 Cellular vitality, increase and transfer. Betulinaldehyde suppresses PLCγ1/Ca2+/MMP9 signal pathway, has a key effect on vascular plasticity, and is available for cardiovascular disease (CVD) research[1][2][3][4].

• HY-N8261

  Amicoumacin B	Inhibitor
  Amicoumacin B can be produced by actinomycete, strain 04-5195T.. Amicoumacin B increases the expression of bone morphogenetic protein 2 (BMP-2). Amicoumacin B has inhibitory effect against C. violaceum (MIC = 250 µg/mL). Amicoumacin B has quorum sensing inhibitory activity, and reduces the expression of the C. violaceum operons vioA, vioB, vioD, and vioE, but increases the expression of vioC[1][2].

• HY-114749

  LL-C 10037α	Inhibitor
  LL-C 10037α is an antitumor antibiotic and can be isolated from Streptomyces[1].

• HY-B1222

  Sisomicin sulfate	Inhibitor
  Sisomicin sulfate is a broad-spectrum aminoglycoside antibiotic produced by Micromonospora inyoensis. Sisomicin sulfate is highly active against Gram-positive bacteria[1][2][3][4].

• HY-129555

  Surfactin	Inhibitor
  Surfactin is a potent cyclic lipopeptide biosurfactants consists of four isomers (Surfactin A, B, C and D), which mediates flux of mono-and divalent cations, such as calcium, across lipid bilayer membranes. Surfactin can act as an antimicrobial adjuvant with anti-bacterial, anti-fungal, antimycoplasma and hemolytic effects[1][2]. Surfactin also has antiviral activity against a variety of enveloped viruses[3].

• HY-B0136R

  Cefdinir (Standard)	Inhibitor
  Cefdinir (Standard) is the analytical standard of Cefdinir. This product is intended for research and analytical applications. Cefdinir (FK-482) is a semi-synthetic, broad-spectrum antibiotic in the third generation of the cephalosporin class, which is proved to be effective for infections caused by several Gram-negative and Gram-positive bacteria. Cefdinir can be used for the research of common bacterial infections of the ear, sinus, throat, and skin[1][2].

• HY-N7057S2

  Nonanoic acid-d4	Inhibitor
  Nonanoic acid-d4 is the deuterium labeled Nonanoic acid. Nonanoic acid is a naturally-occurring saturated fatty acid with nine carbon atoms. Nonanoic acid significantly reduces bacterial translocation, enhances antibacterial activity, and remarkably increases the secretion of porcine β-defensins 1 (pBD-1) and pBD-2[1].

• HY-B2157S

  Robenidine-d8 hydrochloride	Inhibitor
  Robenidine-d8 (hydrochloride) is the deuterium labeled Robenidine hydrochloride. Robenidine hydrochloride is an anticoccidial agent which is also active against MRSA and VRE with MIC50s of 8.1 and 4.7 μM, respectively.

• HY-P4327

  Hispidalin	Inhibitor
  Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative[1].

• HY-N8213

  Rapanone	Inhibitor	99.20%
  Rapanone is a natural benzoquinone. Rapanone exhibits a broad spectrum of biological actions, including anti-tumor, antioxidant, anti-inflammatory, antibacterial and antiparasitic. Rapanone also is a potent and selective human synovial PLA2 inhibitor, with an IC50 of 2.6 μM[1][2][3][4].

• HY-B0465

  Oxacillin sodium monohydrate	Inhibitor	99.55%
  Oxacillin sodium monohydrate is an antibiotic similar to Flucloxacillin used in resistant staphylococci infections study[1].

• HY-N7538

  Dealanylalahopcin
  Dealanylalahopcin is an antimicrobial agent that can be isolated from the culture filtrate of Streptomyces leucoderma subsp. ochraceus. Dealanylalahopcin can also be synthesized by enzymatic hydrolysis of alahopcin by microbial α-amino acid ester hydrolases. Dealanylalahopcin has weak antimicrobial activity against Gram-positive and Gram-negative bacteria and exhibits moderate inhibition of collagen prolyl hydroxylase[1].

• HY-N0126

  Xanthone	Inhibitor
  Xanthone is isolated from Mangosteen and is known to control cell division and growth, apoptosis, inflammation, and metastasis in different stages of carcinogenesis. Xanthone has anti-oxidant, anti-tumor, anti-allergic, anti-inflammatory, anti-bacterial, anti-fungal, and anti-viral activities[1].

• HY-113714

  C562-1101	Inhibitor
  C562-1101 is a small molecule potent botulinum neurotoxins E serotype (BoNT/E) inhibitor[1].

• HY-16487

  Temafloxacin	Inhibitor	99.65%
  Temafloxacin (TMFX) is an orally active quinolone broad-spectrum antibacterial agent. Temafloxacin is well tolerated in lower respiratory and genitourinary tract infections[1][2].

• HY-150588

  InhA-IN-3	Inhibitor
  InhA-IN-3 (Compound TU12) is a Mycobacterium tuberculosis InhA (an enoyl ACP-reductase) inhibitor with an IC50 of 17.7 μM[1].

• HY-Y0366S2

  Lauric acid-d2	Inhibitor
  Lauric acid-d2 is the deuterium labeled Lauric acid. Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively.

• HY-124237

  N-Octanoyl-DL-homoserine lactone	Inhibitor	99.17%
  N-Octanoyl-DL-homoserine lactone is a member of N-acyl homoserine lactones (AHLs) family, also one of the signal molecule of quorum-sensing (QS) signals. N-Octanoyl-DL-homoserine lactone can regulate the production of siderophores and present positive correlation in Aeromonas sobria strain AS7. N-Octanoyl-DL-homoserine lactone can also regulate the secretion of proteases and stimulate the production of total volatile basic nitrogen (TVB-N)[1].

• HY-14655S1

  Sulfasalazine-d3,15N	Inhibitor
  Sulfasalazine-d3,15N is 15N and deuterated labeled Sulfasalazine (HY-14655). Sulfasalazine (NSC 667219) is an anti-rheumatic agent for the research of rheumatoid arthritis and ulcerative colitis. Sulfasalazine can suppress NF-κB activity. Sulfasalazine is a type 1 ferroptosis inducer[1][2][3][4].

• HY-146327

  PqsR/LasR-IN-1	Inhibitor	98.13%
  PqsR/LasR-IN-1 (compound 2a) is a potent PqsR and LasR systems inhibitor. PqsR/LasR-IN-1 has anti-virulence activity against Pseudomonas aeruginosa. PqsR/LasR-IN-1 can reduce production of biofilm, pyocyanin, and rhamnolipids in PA[1].

• HY-77995R

  2-Methoxybenzaldehyde (Standard)	Inhibitor
  2-Methoxybenzaldehyde (Standard) is the analytical standard of 2-Methoxybenzaldehyde. This product is intended for research and analytical applications. 2-Methoxybenzaldehyde (o-Anisaldehyde) is a bacterial/fungal inhibitor with a BA50 value of 0.19 for Salmonella. 2-Methoxybenzaldehyde can be used for the study of bacterial and fungal infectious diseases[1][2][3].

• HY-B0782A

  Acetazolamide sodium	Inhibitor	99.54%
  Acetazolamide sodium is a carbonic anhydrase (CA) IX inhibitor with an IC50 of 30 nM for hCA IX. Acetazolamide sodium has diuretic, antihypertensive and anti-gonococcal activities[1][4][5][6].

• HY-B1325

  Cefuroxime axetil	Inhibitor	99.53%
  Cefuroxime Axetil, a proagent of the cephalosporin cefuroxime and an oarl broad spectrum antibiotic, inhibits several gram-positive and gram-negative organisms, including those most frequently associated with various common community-acquired infections[1].

• HY-B0421A

  Mycophenolic acid sodium	Inhibitor	99.98%
  Mycophenolic acid sodium is a potent uncompetitive inosine monophosphate dehydrogenase (IMPDH) inhibitor with an EC50 of 0.24 μM. Mycophenolic acid sodium demonstrates antiviral effects against a wide range of RNA viruses including influenza. Mycophenolic acid sodium is an immunosuppressive agent. Antiangiogenic and antitumor effects[1][2].

• HY-B0925AS

  Oxacillin-d5
  Oxacillin-d5 is the deuterium labeled Oxacillin[1]. Oxacillin is an orally active synthetic penicillin with good bactericidal activity against staphylococci and other gram-positive pathogens[2].

• HY-163383

  L-Ent-oxPt(IV)
  L-Ent-oxPt IV (L-EOP) is a Oxaliplatin (HY-17371)-based siderophore-platinum conjugate. L-Ent-oxPt IV exhibits selectivity towards Escherichia coli and antibacterial activity through DNA damage[1].

• HY-149929

  EBL-3183	Inhibitor
  EBL-3183, an indole-2-carboxylate, is a potent metallo-β-lactamase (MBL) inhibitor. EBL-3183 is reversibly binding, non-covalent, competitive NDM-1 inhibitor with a pIC50 of 7.7[1].

• HY-W017241R

  1-Naphthalenemethanol (Standard)	Inhibitor
  Norethisterone enanthate (Standard) is the analytical standard of Norethisterone enanthate. This product is intended for research and analytical applications. Norethisterone enanthate is a long-acting parenteral progestogen. Norethisterone enanthate is orally active[1][2][3]. Norethisterone enanthate is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-136071

  QPX7728 methoxy acetoxy methy ester	Inhibitor
  QPX7728 methoxy acetoxy methy ester is a boronic acid β-lactamase inhibitor, exacted from WO2018005662A1, compound 43[1].

• HY-B0398

  Nalidixic acid	Inhibitor
  Nalidixic acid, a quinolone antibiotic, is effective against both gram-positive and gram-negative bacteria. Nalidixic acid acts in a bacteriostatic manner in lower concentrations and is bactericidal in higher concentrations. Nalidixic acid inhibits a subunit of DNA gyrase and topoisomerase IV and reversibly blocks DNA replication in susceptible bacteria[1].

• HY-B0490R

  Hygromycin B (Standard)	Inhibitor
  Hygromycin B (Standard) is the analytical standard of Hygromycin B. This product is intended for research and analytical applications. Hygromycin B is an aminoglycoside antibiotic active against prokaryotic and eukaryotic cells.

• HY-B0337S

  Sulfadimethoxine-d4	Inhibitor
  Sulfadimethoxine-d4 is a deuterium labeled Sulfadimethoxine (Sulphadimethoxine). Sulfadimethoxine is a sulfonamide antibiotic used to treat many infections including treatment of respiratory, urinary tract, enteric, and soft tissue infections[1].

• HY-P2223

  Hypeptin	Inhibitor
  Hypeptin is a cyclo-deposited peptide antibiotic produced by Lysobacter sp.K5869. Hypeptin blocks bacterial cell wall biosynthesis by binding to multiple undecaprenyl pyrophosphate-containing biosynthesis intermediates, forming a stoichiometric 2:1 complex. Hypeptin has antibacterial activity[1].

• HY-113533

  Resolvin D4	Inhibitor
  Resolvin D4 (RvD4), a specialized proresolving mediator, can be produced in bioactive levels during S. aureus infection[1].

• HY-111071

  Nilofabicin	Inhibitor	99.58%
  Nilofabicin is an enoyl-(acyl-carrier protein) reductase (FabI) inhibitor. Nilofabicin had an MIC(90) of 0.5 microg/ml for Staphylococcus aureus strains and was more potent than either linezolid or vancomycin[1].

• HY-108357R

  6-Diazo-5-oxo-L-nor-Leucine (Standard)	Inhibitor

• HY-123354

  SC 44914	Inhibitor
  SC 44914 is a quinoxaline compound with antibacterial effects. SC-44914 has activity against Campylobacter jejuni, C. coli, and Clostridium difficile[1].

• HY-B0925S

  Oxacillin-13C6 sodium	Inhibitor
  Oxacillin-13C6 (sodium) is the 13C6 labeled Oxacillin (sodium). Oxacillin sodium salt is a narrow-spectrum β-lactam antibiotic of the penicillin class.

• HY-125104

  Mirosamicin	Inhibitor
  Mirosamicin is an antibiotic with high antibacterial activity that targets a wide range of gram-positive bacteria and certain Gram-negative bacteria as well as mycoplasma. Mirosamicin can be used for research in the field of food safety monitoring[1].

• HY-B0186A

  Cefoselis hydrochloride	Inhibitor
  Cefoselis hydrochloride, the fourth gen-eration of cephalosporin, is a β-lactam antibiotic. Cefoselis hydrochloride exhibits good activity against a wide range of Gram-positive and Gram-negative organisms. Cefoselis hydrochloride penetrates the blood-brain barrier[1][2][3].

• HY-N0108S

  Physcion-d3	Inhibitor	99.82%
  Physcion-d3 (Parietin-d3) is the deuterium labeled Physcion (HY-N0108). Physcion acts as an inhibitor of 6-phosphogluconate dehydrogenase, with an IC50 and a Kd of 38.5 μM and 26.0 μM, respectively. Physcion exhibits laxative, hepatoprotective, anti-inflammatory, anti-microbial, anti-proliferative and anti-tumor effects[1][2][3].

• HY-B2227A

  Lactate calcium
  Lactate (Lactic acid) calcium is used by the beverage industry as a source of calcium to fortify fruit juice. Lactate calcium facilitates the growth and phytic acid degradation of soybean sprouts[1][2].

• HY-N10128

  (8′α,9′β-Dihydroxy)-3-farnesylindole	Inhibitor
  (8'α,9'β-Dihydroxy)-3-farnesylindole shows strong inhibitory activity (EC50 9.8 μM) against B. subtilis.

• HY-122394

  Thiolactomycin	Inhibitor
  Thiolactomycin is an antibiotic. Thiolactomycin is active against Gram-negative anaerobes. Thiolactomycin also inhibits malaria and trypanosomes. Thiolactomycin is a FabB inhibitor. Thiolactomycin inhibits the synthesis of fatty acids and mycolic acids[1][2].

• HY-P4128

  LL-37 SKE
  LL-37 SKE is an active fragment of LL-37[1].

• HY-B1948R

  Diniconazole (Standard)	Inhibitor
  Diniconazole (Standard) is the analytical standard of Diniconazole. This product is intended for research and analytical applications.

• HY-N12322

  Dihydrotetrodecamycin	Inhibitor
  Dihydrotetrodecamycin is an antibiotic that can be isolated from the fermentation broth of Streptomyces nashvillensis MJ885-mF8. Dihydrotetrodecamycin has MIC values of 50 mg/mL against both Pasteurella piscicida sp. 639 and P. piscicida sp. 6356[1].

• HY-W075770

  Nickel(II) oxide	Antagonist
  Nickel(II) oxide is a chemical compound which nanoparticle form (NiO NPs) exhibits antibacterial, antifungal, antileishmanial, anti-diabetic and anticancer activities. NiO NPs can be activated by ultraviolet and visible light to generate reactive oxygen species, which may be the main cause for the antimicrobial potential[1].

• HY-169132

  Anti-MRSA agent 17	Inhibitor
  Anti-MRSA agent 17 (8) is an inhibitor against S. aureus (MRSA) BPL (SaBPL), with a Ki of 10.3 nM[1].

• HY-W089856R

  Chlorobutanol (hemihydrate) (Standard)	Inhibitor
  Chlorobutanol (hemihydrate) (Standard) is the analytical standard of Chlorobutanol (hemihydrate). This product is intended for research and analytical applications. Chlorobutanol hemihydrate is a pharmaceutical preservative. Chlorobutanol hemihydrate is active against a wide variety of Gram-positive and Gram-negative bacteria, and several mold spores and fungi. Chlorobutanol hemihydrate is widely used in food and cosmetic industry[1][2].

• HY-B0273R

  Sulfadiazine (Standard)	Inhibitor
  Sulfadiazine (Standard) is the analytical standard of Sulfadiazine. This product is intended for research and analytical applications. Sulfadiazine is a sulfonamide antibiotic with antimalarial activity. Sulfadiazine can be used for toxoplasmosis research[1][2].

• HY-158283

  Ethambutol-BSA	Inhibitor
  Ethambutol-BSA is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-114737

  L-573655	Inhibitor
  L-573655 is a reversible inhibitor of UDP-3-O-[R-3-hydroxymyristoyl]-GlcNAc deacetylase with an IC50 value of 8.5 μM. L-573655 possesses antibacterial activity against a wild-type strain of E. coli. with MIC values of 200-400 μg/mL[1].

• HY-P5670

  Maximin 31	Inhibitor
  Maximin 31 is an antimicrobial peptide derived from the toad brain. Maximin 31 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 37.5, 75 μg/mL, respectively[1].

• HY-10581B

  Gatifloxacin mesylate	Inhibitor
  Gatifloxacin mesylate (AM-1155; BMS-206584; PD135432) is a potent fluoroquinolone antibiotic with broad-spectrum antibacterial activity. Gatifloxacin mesylate inhibits bacterial type II topoisomerases (IC50=13.8 μg/ml for S. aureus topoisomerase IV) and E. coli DNA gyrase (IC50 = 0.109 μg/ml)[1]. Gatifloxacin mesylate can be used to treat bacterial conjunctivitis in vivo.

• HY-150767

  KPC-2-IN-2	Inhibitor
  KPC-2-IN-2 (Compound 6c) is a potent Klebsiella pneumoniae carbapenemase (KPC-2) inhibitor (Ki=0.038 μM). KPC-2-IN-2 can enhance the activity of cefotaxime in KPC-2 expressing Escherichia coli[1].

• HY-116060

  RK-286D	Inhibitor
  RK-286D is an antibiotic and a PKC inhibitor with antimicrobial activity. RK-286D shows inhibitory activities against bleb formation induced by PDBu (HY-18985) and in vitro PKC activity[1].

• HY-122356

  Ambazone monohydrate	Inhibitor
  Ambazone monohydrate is an orally active membrane active antitumor agent. Ambazone monohydrate also shows antibacterial and weak antiviral activities[1].

• HY-P5215

  LfcinB 17–28 TFA	Inhibitor
  LfcinB 17–28 TFA has weak antimicrobial activity (MIC: 200 μM against E. coli). LfcinB 17–28 TFA is a fragment of Bovine Lactoferricin (LfcinB)[1].

• HY-106506

  Desciclovir	Control	99.94%
  Desciclovir is a potent and orally active proagent of the antiherpetic agent Acyclovir (ACV). Desciclovir is converted to acyclovir in vivo by xanthine oxidase[1].

• HY-B1128

  Cefamandole	Inhibitor
  Cefamandole is a second-generation broad-spectrum cephalosporin antibiotic.

• HY-146107

  Antitubercular agent-23	Inhibitor
  Antitubercular agent-23 (Compound 3a) is a potent anticandidiasis and antitubercular agent with MIC values of 1.1 µg/ml and 1 µg/ml against Candida albicans MTCC 3017 and M. tuberculosis (H37Rv), respectively[1].

• HY-157084

  HS-291	Inhibitor
  HS-291 is a HtpG inhibitor of Borrelia burgdorferi (Bb). HS-291 contains BX-2819 (high affinity for Bb HtpG), PEG linker, and Verteporfin (HY-B0146) (a photoactive toxin).HS-291 produces reactive oxygen species under light activation to oxidize HtpG and a discrete protein subset near chaperone proteins and can quickly and irreversibly inactivate Bb[1].

• HY-N2552

  Vitamin K5 hydrochloride	Inhibitor	98.00%
  Vitamin K5 hydrochloride is a photosensitizer and a antimicrobial agent. Vitamin K5 hydrochloride is a specific PKM2 inhibitor with IC50 values of 28, 191 and 120 μM for PKM2, PKM1 and PKL. Vitamin K5 hydrochloride induces apoptosis of colon 26 cells. Vitamin K5 hydrochloride can be used for the research of infection and cancer, and it also can be used as a preservative for pharmaceuticals, foods, and beverages[1][2][3].

• HY-B1075AS

  (Rac)-Fosfomycin (benzylamine)-13C3
  (Rac)-Fosfomycin (benzylamine)-13C3 is the 13C labeled Fosfomycin[1]. Fosfomycin (MK-0955) is a broad-spectrum antibiotic. Fosfomycin can cross blood-brain barrier penetrating, and irreversibly inhibits an early stage in cell wall synthesis. Fosfomycin shows anti-bacteria activity for a range of bacteria, including multidrug-resistant (MDR), extensively drug-resistant (XDR), and pan-drug-resistant (PDR) bacteria[2][3].

• HY-N6869

  Dehydroabietic acid	Inhibitor	99.75%
  Dehydroabietic acid is a diterpene resin acid that can be isolated from Pinus and Picea. Dehydroabietic acid has anti-bacterial, anti-fungal, anti-inflammatory, and anticancer activities. Dehydroabietic acid is a dual PPAR-α/γ agonist and PPAR-γ partial agonist, which can attenuate insulin resistance (IR) and hepatic steatosis induced by HFD-consumption in mice[1][2].

• HY-B1360R

  Chlorquinaldol (Standard)	Inhibitor
  Chlorquinaldol (Standard) is the analytical standard of Chlorquinaldol. This product is intended for research and analytical applications. Chlorquinaldol (Chloquinan) is an antibacterial agent with the potential use in topical skin conditions and vaginal infections. Chlorquinaldol is a β-catenin/TCF4 inhibitor, showing anti-proliferation, anti-migration, and apoptosis-inducing activity in cancer cells[1][2].

• HY-121268R

  Demeclocycline (Standard)	Inhibitor
  Demeclocycline (Standard) is the analytical standard of Demeclocycline. This product is intended for research and analytical applications. Demeclocycline is an orally active tetracycline antibiotic. Demeclocycline impairs protein synthesis by binding to the 30S ribosomal subunit to inhibit binding of aminoacyl tRNA. Demeclocycline shows anti-bacterial activitise to a wide variety of bacterial infections[1][2].

• HY-W012634S

  Benzothiazole-d4	Inhibitor
  Benzothiazole-d4 is a deuterium labeled Benzothiazole (HY-W012634). Benzothiazole is a natural occurring heterocyclic nuclei. Benzothiazole nucleus possesses a number of biological activities such as anticancer, antimicrobial, antidiabetic, anti-inflammatory, antileishmanial, and antiviral[1][2].

• HY-130282

  Ianthelliformisamine C ditrifluoroacetate	Inhibitor
  Ianthelliformisamine C ditrifluoroacetate is an antibiotic enhancer with activity against resistant Gram-negative bacteria. Ianthelliformisamine C ditrifluoroacetate has been shown to improve the efficacy of doxycycline against Pseudomonas aeruginosa. Ianthelliformisamine C ditrifluoroacetate was prepared using peptide coupling, resulting in high chemical yields of 27 to 91%. Ianthelliformisamine C ditrifluoroacetate exhibits its mechanism of action by inducing ATP efflux and causing membrane depolarization in bacterial cells.

• HY-P1632A

  Tachyplesin I TFA	Inhibitor
  Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane[1].

• HY-N2387

  Pinosylvin	Inhibitor	99.94%
  Pinosylvin is a?pre-infectious stilbenoid toxin?isolated from the heartwood of Pinus species, has anti-bacterial activities[1]. Pinosylvin is a resveratrol analogue, can induce cell apoptosis and autophapy in leukemia cells[2].

• HY-N6791

  KT5823	Inhibitor
  KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a Staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na+/I- symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation[1][2][3][4][5].

• HY-N8504

  Neoaureothin
  Neoaureothin is a bacterial metabolite that has been found in Streptomyces. It is an androgen receptor (AR) antagonist that inhibits binding of dihydrotestosterone (DHT) to ARs (IC50=13 μM) and inhibits DHT-induced expression of prostate-specific antigen in LNCaP cells (IC50=1.75 nM). Neoaureothin is cytotoxic to A549, HCT116, and HepG2 cells (IC50s=34.3, 47, and 37.2 μg/mL, respectively). It also has nematocidal activity against the pine wood nematode B. xylophilus (LC50=0.84 μg/mL) and increases survival of P. densiflora trees inoculated with B. xylophilus.

• HY-N0517R

  Erianin (Standard)	Inhibitor
  Erianin (Standard) is the analytical standard of Erianin. This product is intended for research and analytical applications. Erianin, often used as an antipyretic and analgesic agent, could inhibit IDO-induced tumor angiogenesis.

• HY-B0278

  Bacitracin Zinc	Inhibitor	98.76%
  Bacitracin Zinc is a complex formed by the binding of Bacitracin (HY-107193) with zinc ions. Bacitracin Zinc is an orally active polypeptide antibiotic with bactericidal properties. Bacitracin Zinc can cause DNA and deoxyribose damage, as well as improve the gut microbiota of broiler and beef cattle[1][2].

• HY-148576

  Antibacterial agent 136
  Antibacterial agent 136 (compound 3) is an antibiotic of oxadiazolones. Antibacterial agent 136 have high antibacterial potency against Staphylococcus aureus (MRSA) with a MIC50 value of 0.8 μM[1].

• HY-B0101A

  Fluconazole hydrate
  Fluconazole (hydrate) is a triazole antifungal drug used in the treatment and prevention of superficial and systemic fungal infections.

• HY-B1682AR

  Loracarbef (hydrate) (Standard)	Inhibitor
  Bupivacaine (hydrochloride monohydrate) (Standard) is the analytical standard of Bupivacaine (hydrochloride monohydrate). This product is intended for research and analytical applications. Bupivacaine hydrochloride monohydrate is a NMDA receptor inhibitor. Bupivacaine hydrochloride monohydrate can block sodium, L-calcium, and potassium channels. Bupivacaine hydrochloride monohydrate potently blocks SCN5A channels with the IC50 of 69.5 μM. Bupivacaine hydrochloride monohydrate can be used for the research of chronic pain[1][2][3].

• HY-N0650R

  L-Serine (Standard)
  L-Serine (Standard) is the analytical standard of L-Serine. This product is intended for research and analytical applications. L-Serine ((-)-Serine; (S)-Serine), one of the so-called non-essential amino acids, plays a central role in cellular proliferation.

• HY-119609

  Ilicicolin C	Inhibitor
  Ilicicolin C exhibits antibacterial activity against Pseudomonas syringae with IC50 of 28.5 µg/mL. Ilicicolin C exhibits weak inhibitory activities against acetylcholinesterase (AChE) and β-glucuronidase with IC50 of 30-43 µg/mL. Ilicicolin C exhibits weak cytoxicity in human lung fibroblasts with IC50 of 64-120 µg/mL. Ilicicolin C affects seed germination and root tip growth of lettuce[1].

• HY-158401

  Antibiofilm agent-7	Inhibitor
  Antibiofilm agent-7 (Compound 9) exhibits potent antibiofilm activity with IC50 of 60, 133.32, and 19.67 µg/mL against S. aureus, E. coli, and methicillin-resistant S. aureus (MRSA), respectively. Antibiofilm agent-7 has antibacterial activity for S. aureus, E. coli, C. albicans, and MRSA, with MIC values of 4.88, 78.13, 9.77 and 39.06 µg/mL, respectively[1].

• HY-Y0366R

  Lauric acid (Standard)	Inhibitor
  Lauric acid (Standard) is the analytical standard of Lauric acid. This product is intended for research and analytical applications. Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively.

• HY-10846

  Delamanid	Inhibitor	99.96%
  Delamanid, a newer mycobacterial cell wall synthesis inhibitor, inhibits the synthesisi of mucolic acids[1].

• HY-146121

  Antitubercular agent-26	Inhibitor
  Antitubercular agent-26 (Compound 32) is an orally active anti-tubercular agent with an extracellular IC50 of 0.50 μM and an intracellular IC50 of 0.51 μM against M. tuberculosis H37Rv. Antitubercular agent-26 shows good metabolic stability, low risk of cardiotoxicity and no genotoxicity[1].

• HY-P1709

  Protactin	Inhibitor
  Protactin is a pentapeptide lactone produced by Streptomyces cucumeris strain L703-4 (ATCC 53784) with significant antioxidant properties. Protactin can be converted to actinomycin Zp by ferrocyanide oxidation. Actinomycin Zp exhibits potent antibacterial activity in vitro and has significant antitumor effects against P-388 leukemia in a mouse model[1].

• HY-N13878

  Anguinomycin B	Inhibitor
  Anguinomycin B is an antitumor antibiotic that shows highly cytotoxic to murine P388 leukemia cells[1].

• HY-120138

  BDM31827	Inhibitor
  BDM31827 is an EthR inhibitor. BDM31827 can be used for multidrug-resistant-tuberculosis research[1].

• HY-148431

  Antimicrobial agent-14	Inhibitor	98.83%
  Antimicrobial agent-14, a benzyl thiophene sulfonamide derivative is an antimicrobial agent, with a MIC of 200 μM against Campylobacter coli ATCC33559. Antimicrobial agent-14 can be used for the research of bacterial foodborne gastroenteritis[1].

• HY-B0159R

  Balofloxacin (Standard)	Inhibitor
  Balofloxacin (Standard) is the analytical standard of Balofloxacin. This product is intended for research and analytical applications. Balofloxacin (Q-35) is an orally active fluoroquinolone antibiotic with broad-spectrum antibacterial activity against gram-negative, gram-positive, and anaerobic bacteria. Balofloxacin can be used for the research of respiratory, intestinal, and urinary tract infections[1][2].

• HY-N8151

  Sanguisorbigenin	Inhibitor	99.11%
  Sanguisorbigenin is a natural antibacterial agent that inhibits methicillin-resistant S. aureus (MRSA)[1].

• HY-A0276

  Gentamicin sulfate	Inhibitor
  Gentamicin sulfate, an orally active aminoglycoside antibiotic, inhibits the growth of both gram-positive and gram-negative bacteria and to inhibit several strains of mycoplasma in tissue culture. Gentamicin sulfate inhibits DNase I with an IC50 of 0.57 mM[1][2][3][4].

• HY-17624AR

  Framycetin (sulfate) (Standard)	Inhibitor
  Framycetin (sulfate) (Standard) is the analytical standard of Framycetin (sulfate). This product is intended for research and analytical applications. Framycetin sulfate (Neomycin B sulfate), an aminoglycoside antibiotic, is a potent RNase P cleavage activity inhibitor with a Ki of 35 μM. Framycetin sulfate competes for specific divalent metal ion binding sites in RNase P RNA. Framycetin sulfate inhibits hammerhead ribozyme with a Ki of 13.5 μM. Framycetin sulfate, a 5″-azido neomycin B precursor, binds the Drosha site in miR-525 and is used for hepatic encephalopathy and enteropathogenic E. coli infections[1][2].

• HY-124431

  Kikumycin A	Inhibitor
  Kikumycin A is an antibiotic, which can be generated from Streptomyces. Kikumycin A exhibits antibacterial activity against Gram-positive and Gram-negative bacteria. Kikumycin A exhibits antitrichomonal activity, with MIC of 25 μg/mL for Trichomonas foetus[1].

• HY-N2092

  Atractylodinol	Inhibitor
  Atractylodinol, an antimicrobial, is a PRRSV (porcine reproductive and respiratory syndrome virus) inhibitor. Atractylodinol inhibits TGF-β receptor I recycling by binding to vimentin (KD of 454 nM) and inducing the formation of filamentous aggregates[1][2].

• HY-N0444R

  Rubiadin (Standard)	Inhibitor
  Rubiadin (Standard) is the analytical standard of Rubiadin. This product is intended for research and analytical applications. Rubiadin is a dihydroxy anthraquinone isolated from Rubia cordifolia. Rubiadin has a potent antixidant activity[1].

• HY-17518R

  Valifenalate (Standard)	Inhibitor
  Valifenalate (Standard) is the analytical standard of Valifenalate. This product is intended for research and analytical applications.

• HY-169973

  PhoPS	Inhibitor
  PhoPS is the photocaged inhibitor for β-lactamase. PhoPS is activated upon light irradiation, and active β-lactamase inhibitor Sulbactam (HY-B0334) is released. PhoPS inhibits the synthesis of bacterial cell wall and the formation of E. coli biofilm, exhibits antimicrobial activity[1].

• HY-W129661

  Pyrazine-2-carbothioamide	Inhibitor
  Pyrazine-2-carbothioamide is an effective antituberculosis agent with inhibitory activity against mycobacterium in vitro[1].

• HY-111278

  Pyocyanin	Inhibitor	99.23%
  Pyocyanin (Pyocyanine) is a toxic, quorum sensing (QS) controlled metabolite produced by Pseudomonas aeruginosa. Pyocyanin is a REDOX active compound that promotes the production of reactive oxygen species (ROS). Pyocyanin has antibacterial and anti-inflammatory activity[1][2][3][4].

• HY-B0417AR

  Lincomycin (hydrochloride) (Standard)	Inhibitor
  Lincomycin (hydrochloride) (Standard) is the analytical standard of Lincomycin (hydrochloride). This product is intended for research and analytical applications. 0

• HY-W748013

  Cervinomycin A2	Inhibitor
  Cervinomycin A2 is an anti-anaerobic antibiotic that can be isolated from Streptomyces cervicalis. Cervinomycin A2 has a strong inhibitory effect on Clostridium perfringens, Gastrococcus prophylacticus, and Bacteroides fragilis[1].

• HY-B1358

  Lincomycin hydrochloride monohydrate	Inhibitor
  Lincomycin hydrochloride monohydrate is a narrow-spectrum antibiotic, has similar effects to erythromycin, which has a good effect on gram-positive coccus, mainly used to inhibit the synthesis of bacterial cell protein[1][2].

• HY-121782

  A 65281	Inhibitor
  A 65281 is a potent DNA gyrase inhibitor with an IC50 value of 0.1 µg/mL. A 65281 induces DNA breakage mediated by calf thymus topoisomerase II. A 65281 inhibits P4 DNA unknotting with an IC50 value of 8 µg/mL[1].

• HY-P4816

  Pseudin-2	Inhibitor
  Pseudin-2, an AMP thast could be isolated from the skin of the South American paradoxical frog Pseudis paradoxa, exert a potent growth inhibitory effect against Gram-negative bacteria[1].

• HY-B0691

  Ecabet	Inhibitor
  Ecabet sodium (TA-2711) is currently applied to some clinical gastrointestinal disease by inhibiting the ROS production and improving Helicobacter pylori eradication[1]. Ecabet sodium reduces apoptosis[2]

• HY-N1441

  Afzelin	Inhibitor	99.62%
  Afzelin (Kaempferol-3-O-rhamnoside)It is a flavonol glycoside that has anti-inflammatory, anti-oxidative stress response, anti-apoptotic, and anti-cardiac cytotoxic effects. AfzelinIt can reduce mitochondrial damage, enhance mitochondrial biosynthesis, and reduce mitochondria-related proteins. Parkinand PTENinduced putative kinase 1 (putative kinase 1)s level. AfzelinCan be improved D-galactosamine(GalN)/LPSSurvival rate of mice treated with doxorubicin prophylaxis (HY-15142A)Induced cardiotoxicity and scopolamine (HY-N0296)-induced neurological injury. AfzelinAlso inhibits asthma and allergies caused by ovalbumin[1][2][3][4].

• HY-P3328

  MDP1	Inhibitor
  MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa[1].

• HY-105321

  PBT 1033		99.51%
  PBT 1033 (PBT 2) is an orally active copper/zinc ionophore. PBT 1033 restores cognition in mouse models of Alzheimer's disease (AD). PB 1033 also has antibacterial activity against Gram-positive bacteria[1][2].

• HY-124286

  N-cis-Tetradec-9Z-enoyl-L-homoserine lactone
  N-cis-Tetradec-9Z-enoyl-L-homoserine lactone (C14-9Z-HSL) is an autoinducer in C. rodentium, that serves as signal molecule, coordinates the gene expression and behaviors through diffusion into cells of different bacterial species[1].

• HY-12824R

  RNPA1000 (Standard)	Inhibitor
  Phenyl salicylate (Standard) is the analytical standard of Phenyl salicylate. This product is intended for research and analytical applications. Phenyl salicylate (PS) has antibacterial activity when hydrolyzed in small intestine and is often used as nervous system inhibitor and intestinal preservative[1].

• HY-W836186

  Cyclo(Leu-Ala)	Inhibitor
  Cyclo(Leu-Ala) (Cyclo(alanine-leucine)) is an antimicrobial compound isolated from microorganisms and has antimicrobial activity against some plant pathogens together with other compounds.

• HY-P2920

  Protamine from salmon	Inhibitor
  Protamine from salmon is a biochemical agent with antioxidant, antiheparin and antimicrobial activities. Protamine from salmon neutralizes the anticoagulant effect of heparin, thereby preventing the formation of antithrombin complexes in canine samples pretreated with heparin in vitro[1].

• HY-126619

  Aspochalasin D	Inhibitor
  Aspochalasin D is a co-metabolite originally isolated from A. microcysticus with aspochalasins A, B, and C, that is initially thought to be inactive. It has antibacterial activity against Gram-positive and Gram-negative bacteria at a concentration of 1 mg/ml.2 Aspochalasin D is more cytotoxic, via apoptosis, to Ba/F3-V12 cells in an IL-3-free medium than in an IL-3-containing medium (IC50s=0.49 and 1.9 μg/mL, respectively).

• HY-119500

  Ilimaquinone	Inhibitor
  Ilimaquinone, a marine sponge metabolite, displays anticancer activity via GADD153-mediated pathway. Ilimaquinone can induce vesiculation of the Golgi apparatus[1]. Ilimaquinone exerts anti-HIV, anti-microbial, anti-inflammatory, and effects[2].

• HY-B1422R

  9-Aminoacridine (Standard)	Inhibitor
  9-Aminoacridine (Standard) is the analytical standard of 9-Aminoacridine. This product is intended for research and analytical applications. 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections[1][2][3].

• HY-B1418R

  Tazobactam (Standard)	Inhibitor
  Tazobactam (Standard) is the analytical standard of Tazobactam. This product is intended for research and analytical applications. Tazobactam (CL-298741) is a potent β-lactamases inhibitor and penicillin antibiotic. Tazobactam has antibacterial activity. Tazobactam can be used for pneumonia research[1][2].

• HY-N0580

  Fraxetin	Inhibitor	99.96%
  Fraxetin is isolated from Fraxinus rhynchophylla Hance and has oral bioactivity. Fraxetin has anti-tumor, antibacterial, antioxidant, and anti-inflammatory effects. Fraxetin can induce cell apoptosis[1][2][3].

• HY-N3636

  (-)-Corypalmine	Inhibitor
  (-)-Corypalmine (Discretinine), an alkaloid that could be isolated from the stem of Guatteriopsis friesiana, possesses antimicrobial activity[1].

• HY-N4302

  Monensin	Inhibitor
  Monensin (Monensin A), an orally active antibiotic, is an ionophore that mediates Na+/H+ exchange. Monensin is a potent Wnt signaling inhibitor. Monensin causes a marked enlargement of the multivesicular bodies (MVBs) and regulates exosome secretion. Monensin can be used for bacterial, fungal, and parasitic infections research, and shows anticancer effects[1][2][3][4].

• HY-16908

  Lefamulin	Inhibitor
  Lefamulin (BC-3781) is an orally active antibiotic. Lefamulin inhibits protein synthesis by binding to the peptidyl transferase center of the 50S bacterial ribosome. Lefamulin has anti-inflammatory activity. Lefamulin can be used in the research of bacterial infections, such as bacterial pneumonia[1].

• HY-N9682

  Syringopicroside	Inhibitor
  Syringopicroside is a natural product that can be isolated from Syringa oblata Lindl. Syringopicroside has antibacterial activity[1].

• HY-N10211

  Saccharothrixin K	Inhibitor
  Saccharothrixin K, a glycosylated saccharothrixin, shows moderate inhibition against Helicobacter pylori G27, H. pylori 159, and Staphylococcus aureus ATCC25923 with MIC values of 16 μg/mL[1].

• HY-P5483

  Retro-indolicidin	Inhibitor
  Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)

• HY-P3361

  IDR-1018	Inhibitor
  IDR-1018 is an innate defense regulator conjugate, with MICs of 16 μg/mL for MRSA USA300 LAC, MRSA SAP 0017 and S. epidermidis ATCC14990. IDR-1018 can be used to synthesis V-IDR1018 (vancomycin-innate defense regulator conjugate)[1][2].

• HY-N6784

  Oligomycin B	Inhibitor
  Oligomycin B is an antibiotic isolated from marine Streptomyces, used as an eukaryotic ATP synthase inhibitor, induces apoptosis[1][2].

• HY-10844S

  Pretomanid-d4	Inhibitor
  Pretomanid-d4 is the deuterium labeled Pretomanid. Pretomanid (PA-824) is an antibiotic used for the research of multi-drug-resistant tuberculosis affecting the lungs. Pretomanid exhibits a sub-micromolar MIC against M. tuberculosis (MTB). The MIC values of PA-824 against a panel of MTB pan-sensitive and Rifampin mono-resistant clinical isolates range from 0.015 to 0.25 μg/mL[1][2].

• HY-B0421R

  Mycophenolic acid (Standard)	Inhibitor
  Mycophenolic acid (Standard) is the analytical standard of Mycophenolic acid. This product is intended for research and analytical applications. Mycophenolic acid is a potent uncompetitive inosine monophosphate dehydrogenase (IMPDH) inhibitor with an EC50 of 0.24 μM.?Mycophenolic acid demonstrates antiviral effects against a wide range of RNA viruses including influenza. Mycophenolic acid is an immunosuppressive agent. Antiangiogenic and antitumor effects[1][2].

• HY-169175

  CN-CC-861	Inhibitor
  CN-CC-861 is a broad-spectrum antibiotic. CN-CC-861 shows antibiotic activities for susceptible and multidrug-resistant bacteria. CN-CC-861 shows potent bactericidal activity in vivo[1].

• HY-N1944AR

  cis-Nerolidol (Standard)	Inhibitor
  cis-Nerolidol (Standard) is the analytical standard of cis-Nerolidol. This product is intended for research and analytical applications. cis-Nerolidol is a sesquiterpene alcohol that can be found in various plants. cis-Nerolidol exhibits antioxidant and antibacterial activities. cis-Nerolidol can also potentiate the action of antibiotics[1].

• HY-B1484

  Moxalactam sodium salt	Inhibitor
  Moxalactam (Latamoxef) sodium salt is a synthetic oxa-β-lactam antibiotic. Moxalactam sodium salt has a broad spectrum of activity against Gram-positive and Gram-negative aerobic and anaerobic bacteria. Moxalactam sodium salt inhibits production of β-lactamases[1].

• HY-B1592

  Carbomycin
  Carbomycin is a peptidyl transferase inhibitor with an inhibition rate of 95% at 200 μM[1].

• HY-16158R

  Cyclacillin (Standard)
  DL-Glutamic acid (Standard) is the analytical standard of DL-Glutamic acid. This product is intended for research and analytical applications. DL-Glutamic acid is the conjugate acid of Glutamic acid, which acts as a fundamental metabolite. Comparing with the second phase of polymorphs α and β L-Glutamic acid, DL-Glutamic acid presents better stability[1].

• HY-N5069

  2,3-Didehydrosomnifericin
  2,3-Didehydrosomnifericin is one of withanolides found in Withania somnifera[1].

• HY-N3346

  Macrocarpal A	Inhibitor
  Macrocarpal A (10-epi-Eucarobustol F) is an antibacterial agent, which can be isolated from the leaves of Eucalyptus macrocarpa. Macrocarpal A inhibits the growth of Bacillus subtilis PCI219 (minimum inhibitory concentration below 0.2 µM) and Staphylococcus aureus FDA209P (minimum inhibitory concentration is 0.4 µM)[1].

• HY-Y1718S1

  Tridecanoic acid-d25	Inhibitor
  Tridecanoic acid-d25 is the deuterium labeled Tridecanoic acid. Tridecanoic acid (N-Tridecanoic acid), a 13-carbon medium-chain saturated fatty acid, can serve as an antipersister and antibiofilm agent that may be applied to research bacterial infections. Tridecanoic acid inhibits Escherichia coli persistence and biofilm formation[1].

• HY-B0576

  Sulfacetamide Sodium	Inhibitor	99.71%
  Sulfacetamide Sodium is a sulfonamide-active molecule used in the study of tinea versicolor and rosacea.

• HY-15695R

  Puromycin aminonucleoside (Standard)	Inhibitor

• HY-N0740R

  Jatrorrhizine chloride (Standard)	Inhibitor
  Jatrorrhizine (chloride) (Standard) is the analytical standard of Jatrorrhizine (chloride). This product is intended for research and analytical applications. Jatrorrhizine chloride is an alkaloid isolated from Coptis chinensis with neuroprotective, antimicrobial, antiplasmodial and antioxidant activities[1]. Jatrorrhizine chloride is a potent and orally active inhibitor of AChE (IC50=872 nM) over >115-fold selectivity for BuChE[2]. Jatrorrhizine chloride reduces uptake of serotonin (5-HT) and norepinephrine (NE) via inhibition of uptake-2 transporters[3].

• HY-N3989

  Haplopine	Inhibitor
  Haplopine possesses photo-activated antimicrobial and DNA binding activities[1].

• HY-N0525R

  Ethyl gallate (Standard)	Inhibitor
  Ethyl gallate (Standard) is the analytical standard of Ethyl gallate. This product is intended for research and analytical applications. Ethyl gallate is a nonflavonoid phenolic compound and also a scavenger of hydrogen peroxide.

• HY-162957

  LasR-IN-5	Inhibitor
  LasR-IN-5 (compound 3C) is a LasR antagonist with an IC50 of 1.37 μM, demonstrating a 77% inhibition of biofilm formation in Pseudomonas aeruginosa. LasR-IN-5 also exhibits quorum sensing (QS) inhibition activity and has potential applications in Pseudomonas aeruginosa infection research[1].

• HY-N7057S1

  Nonanoic acid-d3	Inhibitor
  Nonanoic acid-d3 is the deuterium labeled Nonanoic acid. Nonanoic acid is a naturally-occurring saturated fatty acid with nine carbon atoms. Nonanoic acid significantly reduces bacterial translocation, enhances antibacterial activity, and remarkably increases the secretion of porcine β-defensins 1 (pBD-1) and pBD-2[1].

• HY-17580S

  Fidaxomicin-d7	Inhibitor
  Fidaxomicin-d7 (OPT-80-D7) is the deuterium labeled Fidaxomicin. Fidaxomicin (OPT-80), a macrocyclic RNA polymerase inhibitor, has a narrow spectrum of activity. Fidaxomicin selectively eradicates pathogenic Clostridium difficile with minimal disruption to the multiple species of bacteria that make up the normal, healthy intestinal flora[1][2].

• HY-124093

  8-Deazahomofolic acid	Inhibitor
  8-Deazahomofolic acid is an inhibitor of thymidylate synthase (TS) and other folate-related enzymes. 8-Deazahomofolic acid shows inhibitory activity against folate-dependent S. faecium, L. casei, and MTX (HY-14519) resistant strains. 8-Deazahomofolic acid also inhibits the growth of L1210 leukemia cells, with an IC50 value of 87.5 μM. 8-Deazahomofolic acid can be used in research on bacterial infections and tumors[1].

• HY-A0253

  Cefacetrile	Inhibitor	98.38%
  Cefacetrile (Cephacetrile) is a broad-spectrum antibiotic that is effective in gram-positive and gram-negative bacterial infection[1][2].

• HY-N8228

  17-Hydroxyneomatrine	Inhibitor
  17-Hydroxyneomatrine, extracted from Sophora flavescens, can well inhibit the growth of human cervical carcinoma Hela cells, has the wide-range antibacterial, anti-allergy, anti-tumor, anti-arrhythmia, swelling-subsiding diuresis, immunizing, and biological regulation functions[1].

• HY-N0575

  Pinocembrin	Inhibitor	99.67%
  Pinocembrin ((+)-Pinocoembrin) is a flavonoid found in propolis, acts as a competitive inhibitor of histidine decarboxylase, and is an effective anti-allergic agent, with antioxidant, antimicrobial and anti-inflammatory properties[1].

• HY-76260R

  Faropenem sodium (Standard)	Inhibitor
  Faropenem sodium (Standard) is the analytical standard of Faropenem sodium. This product is intended for research and analytical applications. Faropenem sodium is an orally bioavailable penem antibiotic which can efficiently kill Mycobacterium tuberculosis.

• HY-119982

  Cyclamide	Inhibitor
  Cyclamide (Cicloral), an oligopeptide, can be produced by cyanobacteria algae strains. Cyclamide can be used for the research of diabetes mellitus[1][2].

• HY-B1390B

  Saccharin sodium hydrate	Inhibitor
  Saccharin sodium hydrate is an orally active, non-caloric artificial sweeteners (NAS). Saccharin sodium hydrate has bacteriostatic and microbiome-modulating properties[1].

• HY-N12823

  Caprazene
  Caprazene is an antimycobacterial compound and precursor molecule for semi-synthetic antibacterial antibiotics, used for studies on tuberculosis and Mycobacterium avium complex infections, which can be isolated from the acid-treated caprazamycin (CPZ) A-G mixture[1].

• HY-136821

  Polymyxin D2	Inhibitor
  Polymyxin D2 is an antibiotic discovered from Bacillus polymyxa, exhibiting antibacterial activity. Its core structure consists of a cyclic heptapeptide moiety and a tripeptide side chain with a fatty acyl residue. Polymyxin D2 can be used in anti-infective research[1].

• HY-122139R

  Desethylene Ciprofloxacin (hydrochloride) (Standard)	Inhibitor
  Desethylene Ciprofloxacin (hydrochloride) (Standard) is the analytical standard of Desethylene Ciprofloxacin (hydrochloride). This product is intended for research and analytical applications. Desethylene Ciprofloxacin hydrochloride is a major metabolite of Ciprofloxacin (HY-B0356). Ciprofloxacin is an orally active topoisomerase IV inhibitor. Desethylene Ciprofloxacin hydrochloride has antibacterial activity[1].

• HY-B1743A

  Puromycin dihydrochloride	Inhibitor
  Puromycin dihydrochloride (CL13900 dihydrochloride), an aminonucleoside antibiotic, inhibits protein synthesis[1].

• HY-B0975R

  Penicillin V Potassium (Standard)	Inhibitor
  Penicillin V (Potassium) (Standard) is the analytical standard of Penicillin V (Potassium). This product is intended for research and analytical applications. Penicillin V Potassium (Phenoxymethylpenicillin potassium salt) is an orally active antibiotic. Penicillin V Potassium inhibits the growth of Streptococci, C. difficile and S. aureus. Penicillin V Potassium can be used for the research of otitis, sinusitis, pharyngitis and tonsillitis[1][2][3][4].

• HY-N13031

  Bellericagenin A	Inhibitor
  Bellericagenin A is a pentacyclic triterpenic acid isolated from the bark of Terminalia bellerica. Bellericagenin A exhibits antimicrobial activity. Bellericagenin A exhibits a high affinity to alcohol dehydrogenase (ADH), which has the potential for ameliorating the alcoholic liver injury[1][2].

• HY-B1407R

  Phthalylsulfathiazole (Standard)	Inhibitor
  Phthalylsulfathiazole (Standard) is the analytical standard of Phthalylsulfathiazole. This product is intended for research and analytical applications.

• HY-A0208

  Rosoxacin	Inhibitor
  Rosoxacin (Acrosoxacin) is an orally active and broad-spectrum antibacterial quinolone antibiotic. Rosoxacin inhibits Gram-negative bacteria, including N. gonorrhoeae (MIC range=0.03-0.125 µg/mL).Rosoxacin can be used in studies of urinary tract infections and certain sexually transmitted diseases[1].

• HY-17395R

  Terbinafine hydrochloride (Standard)	Inhibitor
  Terbinafine hydrochloride (Standard) is the analytical standard of Terbinafine hydrochloride. This product is intended for research and analytical applications. Terbinafine hydrochloride (TDT 067 hydrochloride) is an orally active and potent antifungal agent. Terbinafine hydrochloride is a potent non-competitive inhibitor of squalene epoxidase from Candida, with a Ki of 30 nM. Terbinafine hydrochloride also shows antibacterial activity against certain Gram-positive and Gram-negative bacteria[1][2][3]. Terbinafine hydrochloride is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-B0506

  Nadifloxacin	Inhibitor	99.88%
  Nadifloxacin (OPC7251) is a broad-spectrum fluoroquinolone antibiotic that is effective against acne vulgaris.

• HY-10844

  Pretomanid	Inhibitor	99.97%
  Pretomanid (PA-824) is an antibiotic used for the research of multi-drug-resistant tuberculosis affecting the lungs. Pretomanid exhibits a sub-micromolar MIC against M. tuberculosis (MTB). The MIC values of PA-824 against a panel of MTB pan-sensitive and Rifampin mono-resistant clinical isolates range from 0.015 to 0.25 μg/mL.

• HY-N12400

  10-Methyldodec-2-en-4-olide	Inhibitor
  10-Methyldodec-2-en-4-olide is a antibacterial agent and can be isolated from Streptomyces. 10-Methyldodec-2-en-4-olide shows antibacterial activity against B. cinerea, the yeast S. cerevisiae, bacteria S. aureus, and M. luteus[1][2].

• HY-N12145

  Streptimidone	Inhibitor
  Streptimidone (Ao58A) is a bacterial metabolite found in Streptomyces. Streptimidone has antitumor activity[1][2].

• HY-D0896

  ANS	Inhibitor
  ANS (8-Anilino-1-naphthalenesulfonic acid) is a competitive inhibitor targeting thyroxine binding globulin (TBG) (Ki=2.09×106 M-1). ANS is used in radioimmunoassay by displacing bound triiodothyronine (T3) to improve detection sensitivity. ANS can block the protein binding site of T3 and release free T3 for antibody recognition. As a fluorescent probe, ANS can specifically bind to the hydrophobic region of proteins (such as membrane proteins) and monitor the dynamics of protein conformation through changes in fluorescent signals. It is widely used in biochemical research and antibacterial material development[1][2].

• HY-146050

  Antitubercular agent-17	Inhibitor
  Antitubercular agent-17 (Compound 8a) is an antitubercular agent with MIC values of 2, 2, 2 and 128 µg/ml against M. tuberculosis H37Rv, Spec. 192, Spec 210 and Spec. 800, respectively. Antitubercular agent-17 shows highly selective antimycobacterial effects[1].

• HY-12643

  Eprinomectin		98.03%
  Eprinomectin (MK-397) is a type of avermectin. Eprinomectin, as a broad-spectrum fungicide, has insecticidal, insecticidal and acaricidal activities. Eprinomectin induces apoptosis and autophagy in prostate cancer cells and has antitumor activity[1][2][3].

• HY-14768A

  Favipiravir sodium	Inhibitor
  Favipiravir (T-705) sodium is an inhibitor of viral RNA polymerase (RNA polymerase), which is converted into its active form Favipiravir-ribofuranosyl-5′-triphosphate (RTP). Favipiravir-RTP inhibits the activity of influenza virus RNA-dependent RNA polymerase (RdRP) with an IC50 of 341 nM[1][2].

• HY-13777

  Zoledronic Acid
  Zoledronic Acid (Zoledronate) is a third-generation bisphosphonate (BP), with potent anti-resorptive activity. Zoledronic Acid inhibits the differentiation and apoptosis of osteoclasts. Zoledronic Acid also has anti-cancer effects[1].

• HY-15278

  Epothilone D	Inhibitor
  Epothilone D (KOS 862) is a potent microtubule stabilizer.

• HY-B1355AS

  Oxyphenbutazone-d9	Inhibitor
  Oxyphenbutazone-d9 is the deuterium labeled Oxyphenbutazone (HY-B1355A). Oxyphenbutazone is a phenylbutazone derivative, with anti-inflammatory effect. Oxyphenbutazone is a non-selective COX inhibitor. Oxyphenbutazone is the metabolite of Phenylbutazone (HY-B0230). Oxyphenbutazone selectively kills non-replicating Mycobaterium tuberculosis[1][2][3].

• HY-B0329S

  Isoniazid-d4	Inhibitor	99.86%
  Isoniazid-d4 is the deuterium labeled Isoniazid. Isoniazid (INH) is a proagent and must be activated by a bacterial catalase-peroxidase enzyme KatG. Isoniazid is bactericidal to rapidly dividing mycobacteria and has anti-tuberculostatic activity[1][2][3][4].

• HY-W015591R

  Mandelic acid (Standard)	Inhibitor
  Mandelic acid (Standard) is the analytical standard of Mandelic acid. This product is intended for research and analytical applications. Mandelic acid ((±)-Mandelic acid), an alpha-hydroxycarboxylic acid, has been widely used as an intermediate of pharmaceutical and fine chemicals. Mandelic acid shows antimicrobial activity and has been used for the research of urinary tract infections and vaginal trichomoniasis. Mandelic acid exhibits high sperm-immobilizing activity and low vaginal irritation[1][2].

• HY-144722

  Antitubercular agent-12
  Antitubercular agent-12 (Compound 2c) is an antitubercular agent (MIC = 1.439 μg/mL). Antitubercular agent-12 shows greatly lower cytotoxicity (CC50: 57.34 μg/mL)[1].

• HY-B0509B

  Amikacin disulfate	Inhibitor
  Amikacin disulfate (BAY 41-6551 dissulfate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin disulfate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin disulfate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin disulfate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria[1][2].

• HY-N3056

  Pinosylvin monomethyl ether
  Pinosylvin monomethyl ether has antibacterial effect[1] and fungicidal activity[2].

• HY-14784

  Bederocin	Inhibitor
  Bederocin (REP8839) is a Methionyl-tRNA synthetase inhibitor. Bederocin can be used in research of bacterial infection, including S. aureus and MRSA[1].

• HY-B0438R

  Spectinomycin (dihydrochloride) (Standard)	Inhibitor

• HY-N0709

  Coumarin	Inhibitor	99.81%
  Coumarin is a potent and orally active anti-inflammatory agent. Coumarin shows an antinociceptive effect. Coumarin shows antibacterial, antifungal and anticancer activity[1][2].

• HY-B0136

  Cefdinir	Inhibitor	99.50%
  Cefdinir (FK-482) is a semi-synthetic, broad-spectrum antibiotic in the third generation of the cephalosporin class, which is proved to be effective for infections caused by several Gram-negative and Gram-positive bacteria. Cefdinir can be used for the research of common bacterial infections of the ear, sinus, throat, and skin[1][2].

• HY-W017401S

  Benzisothiazolinone-13C5	Inhibitor
  Benzisothiazolinone-13C5 (1,2-Benzothiazol-3-one-13C5) is a 13C-labeled Benzisothiazolinone. Benzisothiazolinone is widely used as an antiseptic and antibacterial agent[1].

• HY-B0545R

  Probenecid (Standard)	Inhibitor	99.00%
  Probenecid (Standard) is the analytical standard of Probenecid. This product is intended for research and analytical applications. Probenecid is a potent and selective agonist of transient receptor potential vanilloid 2 (TRPV2) channels. Probenecid also inhibits pannexin 1 channels.

• HY-155722

  Mtb-IN-5	Inhibitor
  Mtb-IN-5 (compound (-)17j) is an isoxazole, with anti-Mycobacterium tuberculosis (Mtb) activity. Mtb-IN-4 inhibits Mtb respiration and biofilm formation in macrophage, and enhances antibiotic isoniazid (INH) inhibition against INH-resistant Mtb mutant[1].

• HY-N8461R

  Reuterin (Standard)	Inhibitor

• HY-N14185

  Asparenomycin C	Inhibitor
  Asparenomycin C is a carbapenem antibiotic with strong β-lactamase inhibition activities[1].

• HY-162451

  Antibacterial agent 207	Inhibitor
  Antibacterial agent 207 (Compound Ru1) has antibacterial activity against S. aureus (MIC: 1 μg/mL), and low resistance frequencies. Antibacterial agent 207 destroys the bacterial cell membrane, promote production of ROS in bacteria[1].

• HY-103396

  Trimetrexate glucuronate	Inhibitor	98.09%
  Trimetrexate glucuronate (NSC 352122) is a folic acid antagonist. Trimetrexate glucuronate affects DNA and RNA synthesis by inhibiting dihydrofolate reductase and preventing the synthesis of purine nucleotides and thymidylate. Trimetrexate glucuronate has potential antitumour activity and can also be used to inhibit Pneumocystis carinii pneumonia[1][2].

• HY-N3925

  Ganoderol A	Inhibitor
  Ganoderol A is a terpenoid extracted from Ganoderma lucidum with antimicrobial activities. Ganoderol A inhibits cholesterol synthesis pathway and has significant anti-inflammatory activity and protection against ultraviolet A (UVA) damage[1][2].

• HY-N7059

  Lactobionic acid	Inhibitor
  Lactobionic acid is a bionic acid naturally found in the Caspian Sea yogurt and chemically constituted of a gluconic acid bonded to a galactose. Lactobionic acid has antioxidant, antimicrobial, chelating, stabilizer, acidulant, and moisturizing properties[1].

• HY-126735

  Saquayamycin D	Inhibitor
  Saquayamycin D is an antibiotic, which can be isolated from Streptomyces nodosus culture broth. Saquayamycin D exhibits antibacterial activity against various gram-positive bacteria with MIC of 12.5-50 μg/mL. Saquayamycin D inhibits the proliferation of Doxorubicin (HY-15142)-sensitive P388/S and Doxorubicin-resistant P388/ADR with IC50 of 0.15 and 0.15 μg/mL[1].

• HY-W017316R

  Terpinen-4-ol (Standard)
  Terpinen-4-ol (Standard) is the analytical standard of Terpinen-4-ol. This product is intended for research and analytical applications. Terpinen-4-ol (4-Carvomenthenol) is a naturally occurring monoterpene, and can be extracted from a variety of aromatic plants. Terpinen-4-ol is a potent bactericidal agent which possess antifungal , anti-inflammatory and antitumor properties as well, suggesting Terpinen-4-ol to be used for relevant research[1][2].

• HY-122328

  Flambamycin	Inhibitor
  Flambamycin is an antibiotic found in Streptomyces hygroscopicus DS 23230 strain, active against Gram-positive and Gram-negative cocci and some Gram-positive rods. Flambamycin can be used in research on antibiotic screening[1].

• HY-Y0335

  1,3-Dihydroxyacetone	Inhibitor
  1,3-Dihydroxyacetone (DHA), the main active ingredient in sunless tanning skin-care preparations and an important precursor for the synthesis of various fine chemicals, is produced on an industrial scale by microbial fermentation of glycerol (HY-B1659) in Gluconobacter oxydans. 1,3-Dihydroxyacetone is also used for synthesis of new biodegradable polymers by combining with lactic acid (HY-B2227)[1][2].

• HY-B0333S

  Sulfamethizole-d4	Inhibitor
  Sulfamethizole-d4 is the deuterium labeled Sulfamethizole. Sulfamethizole is a sulfathiazole antibacterial agent.

• HY-B1190A

  Cefadroxil hydrate	Inhibitor
  Cefadroxil hydrate (BL-S 578 hydrate) is an orally active and first-generation cephalosporin with a broad spectrum antibacterial activity. Cefadroxil hydrate (BL-S 578 hydrate) also acts as a substrate of the peptide transporter PEPT1 and PEPT2[1][2].

• HY-160202

  18:1 Cardiolipin disodium	Inhibitor	99.90%
  18:1 Cardiolipin disodium is a virulence regulator with two phosphate groups and four acyl chains.18:1 Cardiolipin disodium can be used in the study of the regulation and mechanism of bacterial infection[1].

• HY-16566R

  Kanamycin (Standard)	Inhibitor

• HY-B1597

  Cetalkonium chloride	Inhibitor
  Cetalkonium chloride is an ammonium antiseptic agent used in many topical agents for infections of mouth, throat and eye. Cetalkonium chloride acts as anti-inflammatory amphiphilic agent[1].

• HY-17507

  Pantoprazole		99.94%
  Pantoprazole (BY10232) is an orally active and potent proton pump inhibitor (PPI)[1]. Pantoprazole, a substituted benzimidazole, is a potent H+/K+-ATPase inhibitor with an IC50 of 6.8 μM. Pantoprazole improves pH stability and has anti-secretory, anti-ulcer activities. Pantoprazole significantly increased tumor growth delay combined with Doxorubicin (HY-15142)[3][4].

• HY-W504391

  Nitrovin	Inhibitor
  Nitrovin is an antibacterial growth promoter. Nitrovin induces ROS-mediated non-apoptotic and apoptotic-like cell death by targeting TrxR1. Nitrovin has anticancer activity, with IC50 values of 1.31-6.60 μM for tumor and normal cells[1].

• HY-B0117C

  Tigecycline tetramesylate	Inhibitor
  Tigecycline tetramesylate (GAR-936 tetramesylate) is a broad-spectrum glycylcycline antibiotic. The mean inhibitory concentration (MIC) of Tigecycline for E. coli (MG1655 strain) is approximately 125 ng/mL[1]. MIC50 and MIC90 are 1 and 2 mg/L for Acinetobacter baumannii (A. baumannii), respectively[2].

• HY-P10536

  Temporin SHF	Inhibitor
  Temporin SHF is a broad-spectrum antimicrobial peptide that is active against Gram-positive and Gram-negative bacteria and yeasts, but does not have hemolytic activity. Temporin SHF disrupts the acyl chain stacking of anionic lipid bilayers, leading to cracks and disintegration of microbial membranes. Temporin SHF can be used in the development of antimicrobial drugs[1].

• HY-155834

  DprE1-IN-8	Inhibitor
  DprE1-IN-8 is a potent DprE1 inhibitor with an IC50 value of <0.75 μM. DprE1-IN-8 is against Mtb H37Rv with an IC50 of 6 nM and can be used for tuberculosis research[1].

• HY-146299

  Mt KARI-IN-2	Inhibitor
  Mt KARI-IN-2 (compound 5b) is a potent Mycobacterium tuberculosis ketol-acid reductoisomerase (Mtb KARI) inhibitor with a Ki value of 2.02 μM. Mt KARI-IN-2 has inhibitory activity against Mtb H37Rv (MIC = 0.78 μM) and low cytotoxicity (HEK IC50 > 86 μg/mL)[1].

• HY-151352

  DHDPS-IN-1	Inhibitor
  DHDPS-IN-1 (compound 8) is a DHDPS inhibitor (IC50: 39 μM). DHDPS-IN-1 can be used in the area of antibacterial and herbicidal[1].

• HY-B1674S4

  (±)-Leucine-d7	Inhibitor
  (±)-Leucine-d7 is the deuterium labeled (±)-Leucine. (±)-Leucine (DL-Leucine), an isomer of Leucine, chemosterilant and dietary additive. (±)-Leucine inhibits growth of Escherichia coli HfrH by 92.08%[1].

• HY-130046S1

  16β-Hydroxy-17β-estradiol-2,4-d2
  16β-Hydroxy-17β-estradiol-2,4-d2 is the deuterium labeled 16β-Hydroxy-17β-estradiol-2,4[1].

• HY-121365

  Forphenicinol	Inhibitor
  Forphenicinol is an immunomodulator and a derivative of the bacterial metabolite forphenicine. It increases the phagocytosis of yeast by peritoneal macrophages isolated from thioglycolate-stimulated mice. Forphenicinol (100 μg/animal) prevents cyclophosphamide-induced suppression of delayed-type hypersensitivity (DTH), as well as enhances DTH in response to the hapten oxazolone or sheep red blood cells in mice. It enhances the bactericidal activity of macrophages against P. aeruginosa in mice when administered at a dose of 0.5 mg/kg.2 Forphenicinol (15.6-1,000 μg/animal) increases survival in a mouse model of P. aeruginosa infection. It also inhibits tumor growth in S180 sarcoma and IMC carcinoma mouse xenograft models when administered at doses ranging from 0.05 to 5 mg/kg per day.

• HY-N0006R

  Demethoxycurcumin (Standard)	Inhibitor
  Demethoxycurcumin (Standard) is the analytical standard of Demethoxycurcumin. This product is intended for research and analytical applications. Demethoxycurcumin is one of the main active ingredients of curcumin, which has anti-inflammatory, antioxidant, antibacterial, anti-cancer and neuroprotective effects. Demethoxycurcumin is orally active. Demethoxycurcumin can be used in inflammation, cancer and Alzheimer's disease research[1][2][3][4][5].

• HY-B0810A

  Pivmecillinam hydrochloride	Inhibitor	98.93%
  Pivmecillinam hydrochloride (FL-1039 hydrochloride) is an orally active proagent of mecillinam, an extended-spectrum penicillin antibiotic.

• HY-10218

  Everolimus
  Everolimus (RAD001) is a Rapamycin (HY-10219) derivative and a potent, selective and orally active mTOR1 inhibitor. Everolimus binds to FKBP-12 to generate an immunosuppressive complex. Everolimus inhibits tumor cells proliferation and induces cell apoptosis and autophagy. Everolimus has potent immunosuppressive and anticancer activities[1][2].

• HY-163463

  PTP1B-IN-25	Inhibitor
  PTP1B-IN-25 (Compound 19) is a PTP1B inhibitor with remarkable antiviral, antibacterial, and antidiabetic activities. PTP1B-IN-25 has IC50 values of 0.37 μM, 8.6 μM, 3.7 μM, and 29 μM against PTP1B, HIV, α-Glucosidase, and methicillin-resistant Staphylococcus aureus (MRSA) respectively[1].

• HY-N14183

  Asparenomycin B	Inhibitor
  Asparenomycin B is a carbapenem antibiotic with strong β-lactamase inhibition activities[1].

• HY-B0271S

  Pyrazinamide-d3	Inhibitor	99.84%
  Pyrazinamide-d3 is deuterium labeled Pyrazinamide. Pyrazinamide (Pyrazinecarboxamide; Pyrazinoic acid amide) is a potent and orally active antitubercular antibiotic. Pyrazinamide is a proagent that is converted to the active form pyrazinoic acid (POA) by PZase/nicotinamidase encoded by the pncA gene in M. tuberculosis[1][2].

• HY-150758

  NDM-1 inhibitor-3	Inhibitor	99.41%
  NDM-1 inhibitor-3 (Compound 89) is a New Delhi Metallo-β-lactamase-1 (NDM-1) inhibitor with a Ki of 4 μM[1].

• HY-W007390

  Methyl 2-amino-5-bromobenzoate	Inhibitor	98.89%
  Methyl 2-amino-5-bromobenzoate (compound 8/12) can be used for synthesis of 2-benzamidobenzoic acids, which are known FabH inhibitors. The derivates also inhibit PqsD, the pqs quorum sensing (QS) system of Pseudomonas aeruginosa, involving the production of a number of virulence factors and biofilm formation[1].

• HY-P3913

  Acetyl-Adhesin (1025-1044) amide	Inhibitor
  Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of Streptococcus pyogenes cell surface adhesin that acts as an antimicrobial peptide to specifically inhibit the binding of adhesin to salivary receptors and prevent recolonization of Streptococcus pyogenes[1].

• HY-123635

  Nybomycin	Inhibitor
  Nybomycin, an antibiotic, exhibits antiphage and antibacterial properties. Nybomycin binds to DNA and induces a unique morphological change to mycobacterial bacilli leading the bacterial cell death[1][2].

• HY-W010629R

  2-Chloroacetamide (Standard)	Inhibitor
  2-Chloroacetamide (Standard) is the analytical standard of 2-Chloroacetamide. This product is intended for research and analytical applications. 2-Chloroacetamide is a preservative and is a herbicide for both uplands and paddy fields. 2-Chloroacetamide is a biocide in agriculture, glues, paints and coatings. 2-Chloroacetamide inhibits very-long-chain fatty acid elongase[1][2][3].

• HY-N0052AR

  Sanguinarine (chloride) (Standard)	Inhibitor
  Sanguinarine (chloride) (Standard) is the analytical standard of Sanguinarine (chloride). This product is intended for research and analytical applications. Sanguinarine (Sanguinarin) chloride, a benzophenanthridine alkaloid derived from the root of Sanguinaria Canadensis, can stimulate apoptosis via activating the production of reactive oxygen species (ROS). Sanguinarine-induced apoptosis is associated with the activation of JNK and NF-κB.

• HY-B0537C

  Pentamidine dimesylate	Inhibitor
  Pentamidine (MP-601205) dimesylate is an antimicrobial agent and interferes with DNA biosynthetics. Pentamidine dimesylate inhibits parasite Leishmania infantum with an IC50 of 2.5 μM. Pentamidine dimesylate is a potent and selective protein tyrosine phosphatases (PTPases) and phosphatase of regenerating liver (PRL) inhibitor. Pentamidine dimesylate has the potential for Gambian trypanosomiasis, antimony-resistant leishmaniasis, and Pneumocystis carinii pneumonia treatment. Antitumor and antibacterial activities[1][2][3][4].

• HY-146331

  PC190723	Inhibitor	98.34%
  PC190723 is a bacterial cell division protein FtsZ inhibitor with an IC50 of 55 ng/mL. PC190723 has bactericidal activity against B. subtilis and a variety of staphylococci, with MIC ranging from 0.5 and 1.0 μg/mL. PC190723 exerts antibacterial activity by enhancing FtsZ polymer assembly and inhibiting depolymerization[1][2][3].

• HY-B0957

  Erythromycin Ethylsuccinate	Inhibitor
  Erythromycin Ethylsuccinate is an antibiotic useful for the treatment of a number of bacterial infections, has an antimicrobial spectrum similar to or slightly wider than that of penicillin. Erythromycin Ethylsuccinate has antiviral activity against HIV-1.

• HY-120884

  InhA-IN-5	Inhibitor
  InhA-IN-5 (compound 1) is a potent Mycobacterial tuberculosis (Mtb) trans-2-enoyl-acyl carrier protein reductase (InhA) inhibitor[1].

• HY-162818

  Antibacterial agent 237	Inhibitor
  Antibacterial agent 237 (compound Ru-8) is a bacteriostatic agent for Staphylococcus aureus, with MIC of 0.78-1.56 μg/mL. Antibacterial agent 237 destroys bacterial cell membranes, changes their permeability, and induces bacteria to produce Reactive Oxygen Species, leading to bacterial death without causing drug resistance. Antibacterial agent 237 has low hemolytic toxicity to rabbit red blood cells and Raw 264.7 cells, and has significant antibacterial effects against Staphylococcus aureus in mouse skin wound infection models and Bacillus major larvae infection models[1].

• HY-W097570R

  Sulfamonomethoxine (sodium) (Standard)	Inhibitor
  Sulfamonomethoxine (sodium) (Standard) is the analytical standard of Sulfamonomethoxine (sodium). This product is intended for research and analytical applications. Sulfamonomethoxine sodium is a long acting sulfonamide antibacterial agent, used in blood kinetic studies,and blocks the synthesis of folic acid by inhibiting synthetase of dihydropteroate[1].

• HY-158402

  Anti-inflammatory agent 84	Inhibitor
  Anti-inflammatory agent 84 (Compound 4D) is a derivative of Coumarin (HY-N0709) with antimicrobial and anti-inflammatory activities. Anti-inflammatory agent 84 inhibits E. coli, Candida albicans, Staphylococcus aureus and methicillin-resistant S. aureus (MRSA), with MIC of 312, 156, 19 and 316 μg/mL, respectively. Anti-inflammatory agent 84 inhibits biofilm formation of S. aureus, E. coli and MRSA, with IC50 of 185, 321 and 99 μM, respectively. Anti-inflammatory agent 84 inhibits nitric oxide production in Lipopolysaccharide (HY-D1056)-stimulated RAW264.7 macrophage cell[1].

• HY-W097570

  Sulfamonomethoxine sodium	Inhibitor	99.88%
  Sulfamonomethoxine sodium is a long acting sulfonamide?antibacterial?agent, used in blood kinetic studies,and blocks the synthesis of folic acid by inhibiting synthetase of dihydropteroate[1].

• HY-A0062R

  Telithromycin (Standard)	Inhibitor
  Telithromycin (Standard) is the analytical standard of Telithromycin. This product is intended for research and analytical applications. Telithromycin (HMR3647) is a novel ketolide antibiotic that structurally resembles macrolides. Telithromycin belongs to the ketolide family that is characterized by a keto group at position 3 of the macrolide ring and is active against bacteria causing community-acquired pneumonia, acute exacerbation of chronic bronchitis, and acute sinusitis. Telithromycin also has similar immunomodulatory effects as macrolides. Telithromycin can be used for the research of respiratory infections including bronchial asthma[1][2].

• HY-123252

  Kurchessine	Inhibitor
  Kurchessine (Sarcodinine) is an alkaloid that can be isolated from the stem bark of Holarrhena antidysenterica[1].

• HY-146374

  Antibacterial agent 96	Inhibitor
  Antibacterial agent 96 (compound 4k) is a potent antibacterial agent. Antibacterial agent 96 shows antitubercular activity against agent-susceptible and multidrug-resistantMycobacterium tuberculosis (M. tuberculosis) strains. Antibacterial agent 96 shows toxicity to HepG2 and Vero cells[1].

• HY-U00389

  WQ3810	Inhibitor
  WQ3810 is an orally active fluoroquinolone, with potent antibacterial activities.

• HY-149089

  Antibacterial agent 138	Inhibitor
  Antibacterial agent 138 has excellent antibacterial activity to multi-drug resistant bacteria. Antibacterial agent 138 inhibits bacterial protein synthesis but bacterial cell walls[1].

• HY-N0080

  Ulopterol	Inhibitor
  Ulopterol is a coumarin isolated from the leaves of Toddalia asiatica (L.) Lam with potent antibacterial and antifungal activities[1].

• HY-N6708

  Alamethicin
  Alamethicin, isolated from Trichoderma viride, is a channel-forming peptide antibiotic and induces voltage-gated conductance in model and cell membranes[1][2].

• HY-B0537R

  Pentamidine (Standard)	Inhibitor
  Pentamidine (Standard) is the analytical standard of Pentamidine. This product is intended for research and analytical applications. Pentamidine (MP-601205) is an antimicrobial agent and interferes with DNA biosynthetics. Pentamidine inhibits parasite Leishmania infantum with an IC50 of 2.5 μM. Pentamidine is a potent and selective protein tyrosine phosphatases (PTPases) and phosphatase of regenerating liver (PRL) inhibitor. Pentamidine has the potential for Gambian trypanosomiasis, antimony-resistant leishmaniasis, and Pneumocystis carinii pneumonia treatment. Antitumor and antibacterial activities[1][2][3][4].

• HY-W004520

  Phenazine methylsulfate	Inhibitor
  Phenazine methylsulfate is a free radical generator that can act as an electron transfer reactant in cell viability assays. It also has insecticidal properties. Furthermore, Phenazine methylsulfate induces oxidative DNA damage and cell apoptosis, showing antitumor activity[1][2][3].

• HY-N9087

  Filicenol B
  Filicenol B can be isolated from the whole plant of Adiantum lunulatum. Filicenol B has antibacterial activity[1].

• HY-W017162R

  DL-3-Phenyllactic acid (Standard)	Inhibitor
  DL-3-Phenyllactic acid (Standard) is the analytical standard of DL-3-Phenyllactic acid. This product is intended for research and analytical applications. DL-3-Phenyllactic acid is a broad-spectrum antimicrobial compound.

• HY-W101673R

  Dipropofol (Standard)	Inhibitor
  Dipropofol (Standard) is the analytical standard of Dipropofol. This product is intended for research and analytical applications. Dipropofol is an antioxidant agent[1].

• HY-B0276R

  Ethionamide (Standard)	Inhibitor
  Ethionamide (Standard) is the analytical standard of Ethionamide. This product is intended for research and analytical applications. Ethionamide (2-ethylthioisonicotinamide) is a second-line anti-tuberculosis antibiotic.

• HY-B0535R

  Ethambutol (Standard)	Inhibitor
  Homatropine (hydrochloride) (Standard) is the analytical standard of Homatropine (hydrochloride). This product is intended for research and analytical applications. Homatropine hydrochloride is an orally active anticholinergic agent that rapidly dilates pupils and has cycloplegic effects. Homatropine hydrochloride also has antitussive activity. Homatropine hydrochloride can be used in research on eye diseases and coughs[1].

• HY-W087444A

  (S)-1-(4-Hydroxyphenyl)ethane-1,2-diol	Inhibitor
  (S)-1-(4-Hydroxyphenyl)ethane-1,2-diol is an active constituent of the aerial parts of Angelica sinensis. (S)-1-(4-Hydroxyphenyl)ethane-1,2-diol significantly inhibits the growth of Aeromonas hydrophila. Anticoagulative and antibiotic activities[1].

• HY-B2060S1

  Tiamulin-d10-1 hydrochloride	Inhibitor
  Tiamulin-d10-1 (hydrochloride) is deuterium labeled Tiamulin. Tiamulin (Thiamutilin) is a diterpenic antibiotic that is widely used in pigs and poultry for the control of infectious diseases. Tiamulin is effectively used in the study of airsacculitis, which is primarily caused by Mycoplasma spp[1][2].

• HY-106350

  Cefpimizole	Inhibitor
  Cefpimizole (U-63196E) is a broad-spectrum cephalosporin antibiotic. Cefpimizole inhibits many Ampicillin (HY-B0522)-resistant bacteria, and is active against gram-negative species. Cefpimizole augments phagocytosis of macrophages and neutrophils[1][2].

• HY-B1257

  Cefmetazole sodium	Inhibitor
  Cefmetazole sodium (Sodium cefmetazole) is a semisynthetic cephamycin antibiotic with broad-spectrum antibacterial activity, covering gram-positive, gram-negative, and anaerobic bacteria. Cefmetazole sodium binds to penicillin binding proteins (PBPs), resulting in interfering bacterial cell wall biosynthesis. Cefmetazole sodium is used for the research of gynecologic, intraabdominal, urinary tract, respiratory tract and skin and soft tissue infections[1][2][3].

• HY-118983

  Pivampicillin hydrochloride
  Pivampicillin hydrochloride is a penicillin antibiotic. Pivampicillin hydrochloride is a prodrug of Ampicillin (HY-B0522)[1].

• HY-117224

  Rhizopterin	Agonist
  Rhizopterin is a growth factor that can form rhizobactin de novo in synthetic medium lacking folate[1].

• HY-B1459AR

  Dicloxacillin (Standard)	Inhibitor
  Dicloxacillin (Standard) is the analytical standard of Dicloxacillin. This product is intended for research and analytical applications. Dicloxacillin is a β-lactam antibiotic of the penicillin family. Dicloxacillin against Gram-positive bacteria. Dicloxacillin is active against β-lactamase-producing organisms such as Staphylococcus aureus[1].

• HY-P10694

  IDR-HH2	Inhibitor
  IDR-HH2 is an immunomodulatory peptide with the ability to modulate the host cytokine/chemokine environment. IDR-HH2 can promote the adhesion of monocytes and THP-1 cells to fibronectin. Additionally, IDR-HH2 possesses antibacterial activity, inhibiting the activity of both P. aeruginosa and S. aureus with MIC values of 75 µg/mL and 38 µg/mL, respectively[1][2].

• HY-15306

  Eltrombopag	Inhibitor	99.94%
  Eltrombopag (SB-497115) is an orally active thrombopoietin receptor nonpeptide agonist. Eltrombopag owns thrombopoietic activity, and has been used to research low blood platelet counts with chronic immune thrombocytopenia. Eltrombopag can be used for the research of cardiovascular. Eltrombopag also has highly inhibitory effects against multidrug resistant Staphylococcus aureus. Eltrombopag can induce apoptosis in hepatocellular carcinomab (HCC) as well[1][2][3][4][5].

• HY-B0117S

  Tigecycline-d9	Inhibitor
  Tigecycline-d9 is deuterium labeled Tigecycline. Tigecycline (GAR-936) is a broad-spectrum glycylcycline antibiotic. The mean inhibitory concentration (MIC) of Tigecycline for E. coli (MG1655 strain) is approximately 125 ng/mL[1]. MIC50 and MIC90 are 1 and 2 mg/L for Acinetobacter baumannii (A. baumannii), respectively[2].

• HY-B0212R

  Sulfapyridine (Standard)	Inhibitor
  Sulfapyridine (Standard) is the analytical standard of Sulfapyridine. This product is intended for research and analytical applications. Sulfapyridine, a major metabolite of Sulfasalazine, is a sulfonamide antibiotic agent. Sulfapyridine inhibits recombinant P. carinii dihydropteroate synthetase (DHPS) with an IC50 of 0.18 μM. Sulfapyridine has antibacterial, anti-inflammatory and anti-rheumatic activities[1][2][3].

• HY-N11439

  Albanol B	Inhibitor	99.79%
  Albanol B is an arylbenzofuran derivative which can be isolated from mulberries. Albanol B exhibits anti-Alzheimer's disease, anti-bacterial and antioxidant activities. Albanol B inhibits cancer cells proliferation, down-regulates CDK1 expression. Albanol B also induces cell cycle arrest at G2/M and apoptosis. And Albanol B induces mitochondrial ROS production and increases the phosphorylation levels of AKT and ERK1/2[1].

• HY-N9947

  Methyl-6-gingerol	Inhibitor
  Methyl-6-gingerol is an antimicrobial agent derived from Aframomum melegueta that exhibits anti-mycobacterial activity by inhibiting the efflux of toxins within Mycobacterium species[1].

• HY-125608

  Tiacumicin C	Inhibitor
  Tiacumicin C (Lipiarmycin B3) is an antibiotic with activity against Gram-positive bacteria. Tiacumicin C is employed in research related to bacterial infections[1].

• HY-P10349

  Pap12-6	Inhibitor
  Pap12-6 is a 12-mer peptide derived from the antimicrobial peptide Papiliocin of yellow butterfly larva. Pap12-6 kills bacteria by penetrating and disrupting their membranes, exhibiting strong antibacterial activity. Pap12-6 exerts its anti-inflammatory effects through the TLR4-mediated NF-κB signaling pathway[1].

• HY-14768

  Favipiravir
  Favipiravir (T-705) is a potent viral RNA polymerase inhibitor, it is phosphoribosylated by cellular enzymes to its active form, Favipiravir-ribofuranosyl-5′-triphosphate (RTP). Favipiravir-RTP inhibits the influenza viral RNA-dependent RNA polymerase (RdRP) activity with an IC50 of 341 nM.

• HY-158282

  Pyrazinamide-KLH	Inhibitor
  Pyrazinamide-KLH is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-151937

  Antibacterial agent 127	Inhibitor
  Antibacterial agent 127 (Compound 23) is a potent antibacterial agent[1].

• HY-133592

  Neoabietic acid	Inhibitor
  Neoabietic acid, an abietic-type acid, is a nature product that could be isolated from the oleoresin and rosin of Pinus palustris. Neoabietic acid is highly susceptible to mineral acid. Neoabietic acid has antibacterial activity[1][2][3].

• HY-N7699E

  D-Heptamannuronic acid	Inhibitor
  D-Heptamannuronic acid, an alginate oligomer, is produced by marine brown algae and by a limited range of Gram negative bacteria. D-Heptamannuronic acid can be used for the research of pain and vascular dementia[1][2][3][4].

• HY-W010209S1

  DL-Histidine-15N	Inhibitor
  DL-Histidine-15N is a 15N-labeled Pefloxacin.

• HY-105284A

  Sulopenem sodium	Inhibitor
  Sulopenem (sodium)(CP-70429 (sodium)) is an orally active, parenteral penem antibiotic with broad-spectrum activities against Gram-positive and Gram-negative bacteria. Sulopenem has the potential for urinary tract infections and intra-abdominal infections treatment. Sulopenem is inactive against Pseudomonas aeruginosa and Xanthomonas maltophilia[1][2][3].

• HY-A0090A

  Nitrofurantoin sodium	Inhibitor
  Nitrofurantoin sodium is a potent and orally active antibacterial agent. Nitrofurantoin sodium acts as an antibiotic. Nitrofurantoin sodium can be used for the study of urinary tract infections (UTIs), including cystitis and kidney infections[1][2].

• HY-W013409

  2,4-Dichlorobenzenesulfonyl chloride	Inhibitor
  2,4-Dichlorobenzenesulfonyl chloride (Compound 6d) is a heterocyclic building block, which can be used in the synthesis of nicotinyl arylsulfonylhydrazides with anticancer and antibacterial activities[1].

• HY-B0508R

  Ornidazole (Standard)	Inhibitor
  Ornidazole (Standard) is the analytical standard of Ornidazole. This product is intended for research and analytical applications.

• HY-B0467BR

  Amoxicillin (trihydrate) (Standard)	Inhibitor
  Amoxicillin (trihydrate) (Standard) is the analytical standard of Amoxicillin (trihydrate). This product is intended for research and analytical applications. Amoxicillin (Amoxycillin) trihydrateis an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin trihydrateis inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth[1][2][3].

• HY-119929

  B 669
  B 669, a c10fazimine analogue, is an antimicrobial agent. B 669 has the activity against Mycobacterium ieprae[1].

• HY-118211

  EcDsbB-IN-9	Inhibitor
  EcDsbB-IN-9 (Compound 9) is a potent E. coli DsbB (EcDsbB) inhibitor with an IC50 of 1.7 μM and a Ki of 46 nM[1].

• HY-P10779

  flg22Pst	Inhibitor
  flg22Pst is a peptide that can be derived Pseudomonas syringae pv. tabaci and serves as an effective elicitor for the plant immune system. flg22Pst can induce callose deposition in plants, trigger plant immune responses, and thereby assist plants in defending against pathogen invasion[1].

• HY-16251A

  Hetacillin	Inhibitor
  Hetacillin is a beta-lactam antibiotic that is part of the aminopenicillin family.

• HY-120658

  (Rac)-LY193239
  (Rac)-LY193239 is a racemic modification of LY193239 (HY-120658A). LY193239 is a higher-lactam pyrazolidinone antibacterial agent[1].

• HY-N1428S

  Citric acid-d4	Inhibitor
  Citric acid-d4 is the deuterium labeled Citric acid. Citric acid is a weak organic tricarboxylic acid found in citrus fruits. Citric acid is a natural preservative and food tartness enhancer.

• HY-44178S

  Diethyl butylmalonate-D9
  Diethyl butylmalonate-d9 is the deuterium labeled Diethyl butylmalonate[1]. Diethyl butylmalonate exhibits toxicity to T. pyriformis, with a log(IGC50-1) of 0.557[2].

• HY-150331

  DNA ligase-IN-2	Inhibitor
  DNA ligase-IN-2 (compound 2) is a potent LigA inhibitor and inhibits the DNA-independent autoadenylation activity of both full-length LigA and a truncated enzyme, LigA:AD (IC50=29 nM). DNA ligase-IN-2 effectively inhibits the growth of Staphylococcus aureus in vitro, with MIC valuse of 1, 1, and >64 μg/mL for S. aureus ATCC 29213, S. aureus ATCC 700699 and E. coli ATCC 25922, respectively[1].

• HY-B0398A

  Nalidixic acid sodium salt	Inhibitor	99.83%
  Nalidixic acid sodium salt, a quinolone antibiotic, is effective against both gram-positive and gram-negative bacteria. Nalidixic acid acts in a bacteriostatic manner in lower concentrations and is bactericidal in higher concentrations. Nalidixic acid inhibits a subunit of DNA gyrase and topoisomerase IV and reversibly blocks DNA replication in susceptible bacteria[1][2].

• HY-B0614A

  Mafenide Acetate	Inhibitor	99.91%
  Mafenide Acetate is an effective sulfonamide-type antimicrobial agent used for burn wounds. Mafenide Acetate shows activity against both Gram-positive and Gram-negative organisms, including Pseudomonas aeruginosa, via inhibition of nucleotide synthesis[1][2].

• HY-P5632

  Bovine tracheal antimicrobial peptide	Inhibitor
  Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively[1].

• HY-13858AR

  Sarecycline (hydrochloride) (Standard)	Inhibitor
  Sarecycline (hydrochloride) (Standard) is the analytical standard of Sarecycline (hydrochloride). This product is intended for research and analytical applications. Sarecycline hydrochloride is an orally active narrow-spectrum tetracycline derivative antibiotic. Sarecycline hydrochloride has anti-inflammatory activity. Sarecycline hydrochloride inhibits the activity of Gram-positive bacteria and several types of keratobacterium acnes. Sarecycline hydrochloride interferes with tRNA accommodation and tethers mRNA to the 70S ribosome. Sarecycline hydrochloride can be used to study moderate to severe acne [1][2][3][4][5][6].

• HY-B0333S2

  Sulfamethizole-d4-1
  Sulfamethizole-d4-1 is the deuterium labeled Sulfamethizole[1]. Sulfamethizole is a sulfathiazole antibacterial agent[2][3].

• HY-108718

  G-418
  G-418 (Geneticin) is an aminoglycoside antibiotic with a structure similar to gentamicin. It is toxic to both eukaryotic and prokaryotic cells and works by interfering with protein synthesis[1].

• HY-W007771R

  Acridone (Standard)	Inhibitor
  Acridone (Standard) is the analytical standard of Acridone. This product is intended for research and analytical applications. Acridone is an organic compound based on the acridine skeleton. Acridone has antibacterial, antimalarial, antiviral and anti neoplastic activities[1].

• HY-N0589R

  Dehydrodiisoeugenol (Standard)	Inhibitor
  Dehydrodiisoeugenol (Standard) is the analytical standard of Dehydrodiisoeugenol. This product is intended for research and analytical applications. Dehydrodiisoeugenol is isolated from Myristica fragrans Houtt, shows anti-inflammatory and anti-bacterial actions[1]. Dehydrodiisoeugenol inhibits LPS-stimulated NF-κB activation and cyclooxygenase (COX)-2 gene expression in murine macrophages[2].

• HY-N0716R

  Berberine (Standard)	Inhibitor
  Berberine (Standard) is the analytical standard of Berberine. This product is intended for research and analytical applications. Berberine (Natural Yellow 18) is an alkaloid isolated from the Chinese herbal medicine Huanglian, as an antibiotic. Berberine (Natural Yellow 18) induces reactive oxygen species (ROS) generation and inhibits DNA topoisomerase. Berberine (Natural Yellow 18) has antineoplastic properties. The sulfate form (HY-N0716B) improves bioavailability[1].

• HY-W009497

  Dowicil 200	Inhibitor	98.89%
  Dowicil 200 (Quaternium-15) is a skin toxin and allergen that inhibits the growth of Pinctada fucata cells. Dowicil 200 has antimicrobial activity and is more potent against fungi and molds than against fungi.

• HY-B0147

  Pefloxacin	Inhibitor	99.79%
  Pefloxacin is a an antibacterial agent and prevents bacterial DNA replication by inhibiting DNA gyrase (topoisomerse) Target: DNA gyrase Pefloxacin is a synthetic chemotherapeutic agent used to treat severe and life-threatening bacterial infections.

• HY-123137

  Ro 24-6778	Inhibitor
  Ro 24-6778 is a cephalosporin composed of Desacetylcefotaxime (HY-126129) and Desmethylfleroxacin ester-linked. Ro 24-6778 has high antibacterial activity against a wide range of aerobic bacteria[1].

• HY-149013

  Anti-MRSA agent 5	Antagonist
  Anti-MRSA agent 5 (B14) is a potent MRSA agent with MIC50 values of 0.38 μg/mL and has low hERG activity with an IC50 values of >40 μM. Anti-MRSA agent 5 (B14) also has low cytotoxicity to mammal cells and unlikely to acquire bacterial resistance[1].

• HY-149762

  IMBI	Inhibitor
  IMBI (compound 32) is an antibacterial agent that inhibits quorum sensing (QS) against drug-resistant pathogens. IMBI inhibits biofilm formation of Salmonella marcescens and restores or increases its susceptibility to antimicrobial drugs[1].

• HY-N7111

  Sultamicillin tosylate	Inhibitor
  Sultamicillin tosylate is a broad-spectrum and orally active beta-lactamase inhibitor, an antibiotic with antibacterial activity[1].

• HY-W028047

  JFD01307SC	Inhibitor
  JFD01307SC is a glutamine synthetase inhibitor and anti-tuberculosis agent. JFD01307SC acts as a mimic of L-Glutamate and thus target enzymes involved in glutamine biosynthesis[1].

• HY-W003467R

  Rabeprazole Sulfide (Standard)	Inhibitor
  Rabeprazole Sulfide (Standard) is the analytical standard of Rabeprazole Sulfide. This product is intended for research and analytical applications. Rabeprazole Sulfide is an active metabolite of Rabeprazole. Rabeprazole is a proton pump inhibitor that suppresses gastric acid secretion through an interaction with (H+/K+)-ATPase in gastric parietal cells. Rabeprazole markedly inhibits the motility of H. pylori. Rabeprazole has the potential for various peptic diseases treatment[1][2].

• HY-152117

  Acetyl-CoA Carboxylase-IN-1	Inhibitor	99.16%
  Acetyl-CoA Carboxylase-IN-1 is a potent acetyl-CoA carboxylase (ACC) inhibitor with an IC50 value of ＜5 nM. Acetyl-CoA Carboxylase-IN-1 has antibacterial activity[1].

• HY-B0113AR

  Omeprazole (sodium) (Standard)	Inhibitor
  Omeprazole (sodium) (Standard) is the analytical standard of Omeprazole (sodium). This product is intended for research and analytical applications. Omeprazole sodium (H 16868 sodium), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole sodium shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM[1]. Omeprazole sodium also inhibits growth of Gram-positive and Gram-negative bacteria[2]. Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[3].

• HY-P10696

  C16G2	Inhibitor
  C16G2 is a specific targeted antimicrobial peptide (STAMP) that targets the cariogenic oral pathogen Streptococcus mutans. C16G2 specifically recognizes and disrupts the bacterial cell membrane, causing small molecule leakage and loss of membrane potential, leading to bacterial killing. Unlike broad-spectrum antimicrobial peptides, C16G2 exhibits higher selectivity and efficacy against Streptococcus mutans[1].

• HY-131337

  RhlR antagonist 1	Inhibitor
  RhlR antagonist 1 is a potent RhlR antagonist with an IC50 of 26 μM. RhlR antagonist 1 displays selective RhlR antagonism over LasR and PqsR, strong inhibition of biofilm formation in static and dynamic settings, and reduces production of virulence factors such as rhamnolipid and pyocyanin in P. aeruginosa. RhlR antagonist 1 can be utilized for developing QS-modulating molecules in the control of P. aeruginosa infections[1]. RhlR antagonist 1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-129405

  N-(Ketocaproyl)-DL-homoserine lactone	Inhibitor	98.45%
  N-(Ketocaproyl)-DL-homoserine lactone is a natural, very active ligand of LuxR. N-(Ketocaproyl)-DL-homoserine lactone is a quorum sensing (QS) autoinducer[1].

• HY-161488

  Eugenol/BSA	Inhibitor
  Eugenol/BSA is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-163633

  CYP51-IN-18	Inhibitor
  CYP51-IN-18 (compound 2l) is a potent CYP51 inhibitor with an IC50 of 0.219 μg/mL. CYP51-IN-18 shows significant fungicidal activity against B. cinerea with an EC50 of 0.369 μg/mL[1].

• HY-P5703

  EP5-1	Inhibitor
  EP5-1 is an antimicrobial peptide. EP5-1 has antibacterial and antifungal activities. EP5-1 also shows antitumor activity against cancer cells, and induces cell apoptosis. EP5-1 has antiviral activity against pseudorabies virus (PRV)[1].

• HY-122505

  Cephamycin C
  Cephamycin C (CepC) is a β-lactam antibiotic that can be isolated from the Streptomyces clavuligerus[1].

• HY-P991039

  Zamubafusp alfa
  HY-P991039 is an N-terminal cryptic neo-epitope-targeting Fusion Protein[1].

• HY-N6975

  Glyasperin D	Inhibitor
  Glyasperin D is a flavonoid isolated from Glycyrrhiza uralensis, and possesses weaker anti-Helicobacter pylori activity[1].

• HY-137168

  LAB 149202F	Inhibitor
  LAB 149202F is an acylanilide antimicrobial agent that also has inhibitory effects on strains that produce formyl and phosphate resistance[1].

• HY-B2060R

  Tiamulin (Standard)	Inhibitor
  Tiamulin (Standard) is the analytical standard of Tiamulin. This product is intended for research and analytical applications. Tiamulin (Thiamutilin) is a diterpenic antibiotic that is widely used in pigs and poultry for the control of infectious diseases. Tiamulin is effectively used in the study of airsacculitis, which is primarily caused by Mycoplasma spp[1].

• HY-W007161

  8-Desmethoxy-8-fluoro Moxifloxacin	Inhibitor
  8-Desmethoxy-8-fluoro Moxifloxacin (Compound 07) is an antibacterial agent, and has bactericidal activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Enterococcus faecalis[1].

• HY-B0573CS

  (R)-Propranolol-d7
  (R)-Propranolol-d7 is the deuterium labeled (R)-Propranolol[1].

• HY-122139

  Desethylene Ciprofloxacin hydrochloride	Inhibitor
  Desethylene Ciprofloxacin hydrochloride is a major metabolite of Ciprofloxacin (HY-B0356). Ciprofloxacin is an orally active topoisomerase IV inhibitor. Desethylene Ciprofloxacin hydrochloride has antibacterial activity[1].

• HY-P0269

  Magainin 1	Inhibitor	99.90%
  Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria[1][2][3].

• HY-B0692R

  Cefepime (Standard)
  Cefepime (Standard) is the analytical standard of Cefepime. This product is intended for research and analytical applications. Cefepime (BMY-28142) is a broad-spectrum and cross the blood-brain barrier cephalosporin. Cefepime shows antibacterial effects against both Gram-positive and Gram-negative aerobic bacteria. Cefepime induces neurotoxicity[1][2][3][4].

• HY-17358

  Loteprednol Etabonate	Inhibitor	99.53%
  Loteprednol etabonate (LE) is an orally active "soft" steroid belonging to a unique class of glucocorticoids. Loteprednol etabonate (LE) exhibits anti-inflammatory activity and has been used in optometry and ophthalmology[1][2][3].

• HY-B0026

  Ceftiofur hydrochloride	Inhibitor	98.43%
  Ceftiofur hydrochloride is a semisynthetic antibiotic, with activity against various gram-positive and gram-negative, aerobic and anaerobic bacteria encountered by domestic animals[1].

• HY-A0088R

  Cefotaxime (sodium) (Standard)	Inhibitor
  Cefotaxime (sodium) (Standard) is the analytical standard of Cefotaxime (sodium). This product is intended for research and analytical applications. Cefotaxime (Cefotaxim) sodium, a β-lactamase stable cephalosporin and a third-generation cephalosporin antibiotic, possesses broad-spectrum antibiotic activity against numerous Gram-positive and Gram-negative bacteria[1][2][3][4][5].

• HY-P5599

  Temporin K	Inhibitor
  Temporin K is an antimicrobial peptide against Legionella pneumophila[1].

• HY-152175

  Antibacterial agent 130	Inhibitor
  Antibacterial agent 130 is a 1,1-diarylthiogalactoside, used for targeting the Pseudomonas aeruginosa LecA. Antibacterial agent 130 shows high affinity toward LecA (Kd=1 μM). Antibacterial agent 130 has antibiofilm activity, but lacks bactericidal activity. LecA, a lectin and virulence factor from Pseudomonas aeruginosa involved in bacterial adhesion and biofilm formation[1].

• HY-117005

  C450-0730	Inhibitor
  C450-0730 is an antagonist targeting the AHL membrane-bound sensor kinase and is an antagonist of the nine-transmembrane protein LuxN of Vibrio harveyi . C450-0730 competitively binds to the LuxN AI-1 binding site and specifically antagonizes the LuxN/AI-1 quorum sensing signal in Vibrio harveyi. The inhibitory activity of C450-0730 against LuxNI209F was not significant[1].

• HY-P1452A

  RNAIII-inhibiting peptide(TFA)	Inhibitor	99.19%
  RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.

• HY-B1459

  Dicloxacillin sodium	Inhibitor
  Dicloxacillin sodium is a β-lactam antibiotic of the penicillin family. Dicloxacillin sodium against Gram-positive bacteria. Dicloxacillin sodium is active against β-lactamase-producing organisms such as Staphylococcus aureus[1].

• HY-130753

  JM 1397	Inhibitor
  JM 1397 is an antibacterial agent that exhibits potent antibacterial activity against both methicillin-susceptible and methicillin-resistant Staphylococcus aureus with a minimum inhibitory concentration (MIC90) of 1 μg/mL[1].[1].

• HY-W237498

  Urease-IN-17	Inhibitor
  Urease-IN-17 (9) is a urease inhibitor, with an IC50 of 84 μM[1].

• HY-156004

  Ziapin 2	Inhibitor	99.62%
  Ziapin 2 is a molecular optomechanical light transducer. Ziapin 2 is an amphiphilic azobenzene with a strong non-covalent affinity to the plasma membrane. Ziapin 2 can be used to photo-modulate the membrane potential in cells of the Gram-positive bacterium Bacillus subtilis. Ziapin 2 enters the lipid membrane very rapidly (≈ 40 ns)[1][2].

• HY-139748

  ETX0462
  ETX0462 is a gram-negative chemotype antibiotic. ETX0462 has potent in vitro and in vivo activity against Pseudomonas aeruginosa plus all other Gram-negative ESKAPE pathogens, Stenotrophomonas maltophilia and biothreat pathogens[1].

• HY-100180

  Delpazolid	Inhibitor	98.02%
  Delpazolid is a novel oxazolidinone antibiotic agent which can inhibit the growth of MSSA and MRSA with a MIC90 of 2 μg/mL for both of them.

• HY-155461

  Antibiofilm agent-3	Inhibitor
  Antibiofilm agent-3 (compound 3b) is a tetracarboxamide antibacterial agent that effectively inhibits the plant bacterial pathogen Xanthomonas citri (Xanthomonas citri ssp. citri, Xcc) (MIC=500 μg/ mL). Antibiofilm agent-3 inhibits biofilm formation by Xcc with IC50=15.37 μg/mL[1].

• HY-107486R

  Nosiheptide (Standard)	Inhibitor
  Nosiheptide (Standard) is the analytical standard of Nosiheptide. This product is intended for research and analytical applications. Nosiheptide (Multhiomycin), a thiopeptide antibiotic produced by Streptomyces actuosus, inhibits bacterial protein synthesis and bears a unique indole side ring system and regiospecific hydroxyl groups on the characteristic macrocyclic core. Nosiheptide has been widely used as a feed additive for animal growth[1][2].

• HY-139743

  Aditoprime	Inhibitor	99.68%
  Aditoprime (Aditoprim), a selective bacterial dihydrofolate reductase (DHFR) inhibitor, inhibits the transformation of dihydrofolic acid to tetrahydrofolic acid. Aditoprime inhibits E.coli and L.casei DHFR with IC50 of 47 and 520 nM, respectively. Aditoprime has a broad antimicrobial spectrum, good antibacterial activity and excellent pharmacokinetics[1][2][3].

• HY-P1934AR

  Cyclo(L-Phe-L-Pro) (Standard)	Inhibitor
  Gallic acid (hydrate) (Standard) is the analytical standard of Gallic acid (hydrate). This product is intended for research and analytical applications. Gallic acid (3,4,5-Trihydroxybenzoic acid) hydrate is a natural polyhydroxyphenolic compound and an free radical scavenger to inhibit cyclooxygenase-2 (COX-2)[1]. Gallic acid hydrate has various activities, such as antimicrobial, antioxidant, antimicrobial, anti-inflammatory, and anticance activities[2].

• HY-156369

  Urease-IN-9	Inhibitor
  Urease-IN-9 (Compound 1e) is an urease inhibitor (IC50: 19.5?μM)[1].

• HY-P3473

  Evybactin	Inhibitor
  Evybactin is a DNA gyrase inhibitor. Evybactin is a selective inhibitor of Mycobacterium tuberculosis with a MIC value of 0.25 µg/mL. Evybactin is the first antimicrobial compound found to employ this unusual mechanism of selectivity[1].

• HY-123451

  ACH-702	Inhibitor
  ACH-702 is a potent anti-tubercular agent. ACH-702 also shows broad-spectrum antibacterial activity[1][2].

• HY-111264

  Naphthomycin B	Inhibitor
  Naphthomycin B is an antibiotic, which is initially isolated from Streptomyces sp. Naphthomycin B exhibits antimicrobial activities against gram positive bacteria and many fungis[1].

• HY-P10540

  Pantinin-2	Inhibitor
  Pantinin-2 is a cysteine-free toxic peptide found in the emperor scorpion (paninus imperator). Pantinin-2 has high activity against Gram-positive bacteria but weak activity against Gram-negative bacteria. Pantinin-2 also exhibits activity against Candida tropicalis and has relatively mild hemolytic activity against human erythrocytes. Pantinin-2 can be used in the development of antimicrobial drugs for drug-resistant pathogens[1].

• HY-W045071

  N-Hexanoyl-DL-homoserine lactone
  N-Hexanoyl-DL-homoserine lactone is a bacterial quorum sensing molecule produced in the rhizosphere. N-Hexanoyl-DL-homoserine lactone, a bacterial quorum sensing signal, induces transcriptional changes in Arabidopsis and may contribute to tuning plant growth to the microbial composition of the rhizosphere[1].

• HY-W041988

  Fmoc-Glu-OMe	Inhibitor	99.74%
  Fmoc-Glu-OMe, a glutamic acid derivative, shows antibacterial activity and gelation property in AgNO3 solution. Fmoc-Glu-OMe is a mouldable wound healing biomaterial[1].

• HY-156005

  Antibacterial agent 153	Inhibitor
  Antibacterial agent 153 is a broad-spectrum antibacterial agent. Antibacterial agent 153 kills bacteria by acting on the bacterial cell membrane. Antibacterial agent 153 can be used for bacterial infections research[1].

• HY-W040022R

  Cefcapene pivoxil (hydrochloride hydrate) (Standard)	Inhibitor
  Cefcapene pivoxil (hydrochloride hydrate) (Standard) is the analytical standard of Cefcapene pivoxil (hydrochloride hydrate). This product is intended for research and analytical applications. Cefcapene pivoxil hydrochloride hydrate, the pivalate ester prodrug form of Cefcapene, is an orally active third-generation cephalosporin with a wide spectrum of anti-bacterial activity. Cefcapene pivoxil hydrochloride hydrate has the potential for the palmoplantar pustulosis (PPP) research[1][2].

• HY-123162A

  Astromicin disulfate	Inhibitor
  Astromicin disulfate is a water-soluble aminoglycoside antibiotic that can be isolated from the genus Micromonospora. Astromicin disulfate exhibits broad spectrum antibacterial activity against gram positive and negative bacteria[1][2][3].

• HY-14397AR

  Indomethacin (sodium hydrate) (Standard)
  Dimethenamide-P (Standard) is the analytical standard of Dimethenamide-P. This product is intended for research and analytical applications. Dimethenamide-P is an amide herbicide effective for the pre-emergence management of annual grasses, small-seeded broadleaf weeds, and sedges in ornamental plants, functioning by inhibiting the synthesis of long-chain fatty acids.

• HY-106571

  Cefteram pivoxil	Inhibitor
  Cefteram pivoxil (Ro 19-5248), an orally active cephalosporin antibiotic, is used for bacterial infections[1].

• HY-169384

  Antimycobacterial agent-10	Inhibitor
  Antimycobacterial agent-10 (compound 5) is a DNA gyrase inhibitor with anti-bacterial actiity (IC50=96 nM, M. tuberculosis gyrase).

• HY-17591R

  Penicillin G potassium (Standard)	Inhibitor
  Penicillin G (potassium) (Standard) is the analytical standard of Penicillin G (potassium). This product is intended for research and analytical applications. Penicillin G potassium is a fast-acting penicillin family antibiotic. Penicillin G potassium can be used for the research of bacterial infections that affect the blood, heart, lungs, joints, and genital areas[1][2].

• HY-W782079

  Geraniol-d6 (Major)	Inhibitor
  Geraniol-d6 (Major) is the deuterated labeled Geraniol (Major). Geraniol is an olefin terpene with oral activity. Geraniol inhibits cell proliferation and promotes apoptosis. Geraniol has antibacterial, antifungal, antioxidant, anti-inflammatory and antitumor activities. Geraniol can be used to study diabetes[1][2][3][4][5].

• HY-125676

  Thermopterin	Inhibitor
  Thermopterin is a derivative of the antimicrobial agent Pterin (HY-W037825) isolated from Methanoculleus thermophilus[1].

• HY-123589

  Gyramide A	Inhibitor
  Gyramide A is a compound mentioned in the study of the protective effect of Qnr protein on bacterial topoisomerase. Qnr has no protective effect on it, and its activity is different from that of other topoisomerase inhibitors.

• HY-P2317A

  Cecropin P1, porcine acetate	Inhibitor
  Cecropin P1, porcine acetate is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine acetate shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine acetate shows antiviral activity and inhibits PRRSV infection[1][2].

• HY-20457

  TL8-506	Inhibitor
  TL8-506 is a specific TLR8 agonist with an EC50 of 30 nM. TL8-506 has immunomodulatory effects and can be used in the study of tuberculosis and cancer immunotherapy[1][2].

• HY-116010A

  Oleandomycin phosphate	Inhibitor
  Oleandomycin phosphate is a macrolide antibiotic structurally closely related to Erythromycin. Oleandomycin is similar to Erythromycin with antimicrobial activity. Oleandomycin inhibits protein synthesis by interference with translation of activated amino acids to nascent peptide chains on the ribosomes[1][2].

• HY-D1005A9

  Poloxamer 183 (L63)	Inhibitor
  Poloxamer 183 L63 is block polymer of polyoxyethylene and polyoxypropylene with average molecular mass of 2650. Poloxamer 183 L63 exhibits antimicrobial activity, that inihibits 83% Mycobacterium avium complex at concentration of 1 mg/mL. Poloxamer 183 L63 forms thermoreversible hydrogel, that is utilized in food additives, drug delivery carriers in cosmetics, pharmaceutical ingredients and tissue engineering[1][2].

• HY-W012875R

  3-Nitropropanoic acid (Standard)	Inhibitor

• HY-W295873

  Cyclo(Phe-Gly)	Inhibitor	98.48%
  Cyclo(Phe-Gly) is a cyclodipeptides with antimicrobial and anticancer activities, isolated from broth culture of endophytic Streptomyces YIM 64018 associated with Paraboea sinensis[1].

• HY-161728

  Antibacterial agent 223	Inhibitor
  Antibacterial agent 223 (compound D8-03) is an inhibitor of Francisella tularensis. Antibacterial agent 223 can inhibit intracellular growth of Francisella tularensis in mice[1].

• HY-144381

  Glutamate-5-kinase-IN-1
  Glutamate-5-kinase-IN-1 (compound 50) is a potent glutamate-5-kinase (G5K) inhibitor with an MIC (minimum inhibitory concentration) of 4.1 µM. Glutamate-5-kinase-IN-1 shows G5K inhibition by alters the ATP binding site architecture for enzyme recognition. Glutamate-5-kinase-IN-1 has the potential for the research of anti-TB agents[1].

• HY-N13981

  Arylomycin B2	Inhibitor
  Arylomycin B2, an antibiotic, is a potent signal peptidase I (SPase I) inhibitor. Arylomycin B2 has anti-Gram-positive bacteria activities[1].

• HY-130840

  LolCDE-IN-2	Inhibitor
  LolCDE-IN-2 is a potent Lol protein (LolCDE) inhibitor. LolCDE-IN-2 inhibits E. coli MG1655 with a MIC of 2 μg/ml. Antibacterial activity[1].

• HY-P5629

  MCF	Inhibitor
  MCF is an antimicrobial peptide derived from bee venom. MCF has activity against E.coli W 160-37, S.aureus 8530 and B.subtilis, the MIC values are 35-45 μg/ml, 25-35 μg/ml and 15-25 μg/ml[1].

• HY-10581AS1

  Gatifloxacin-d4 hydrochloride	Inhibitor
  Gatifloxacin-d4 (AM-1155-d4; BMS-206584-d4; PD135432-d4) hydrochloride is deuterium-labeled Gatifloxacin (hydrochloride) (HY-10581A)[1].

• HY-P5653

  Bombolitin III
  Bombolitin III is an antimicrobial peptide derived from bumblebee venom. Bombolitin III can lysate erythrocyte and liposome[1].

• HY-P0261A

  Indolicidin acetate	Inhibitor	99.83%
  Indolicidin acetate is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils[1].

• HY-B0555B

  Nafcillin sodium	Inhibitor
  Nafcillin sodium, an antibiotic, is a reversible inhibitor of β-lactamase. Nafcillin sodium can be used for the research of staphylococcal infections[1][2].

• HY-12826

  IMB-XH1	Inhibitor
  IMB-XH1 is an inhibitor of myeloid cell factor 1 (Mcl-1)[1]. IMB-XH1 is a non-competitive Delhi metallo-β-lactamase (NDM-1) inhibitor. The IC50s of IMB-XH1 against metallo-β-lactamases NDM-1, IMP-4, ImiS and L1 are 0.4637 μM, 3.980 μM, 0.2287 μM and 1.158 μM, respectively[2].

• HY-169191

  Quorum sensing-IN-8	Inhibitor
  Quorum sensing-IN-8 (compound 5e) has anti-biofilm activity. Quorum sensing-IN-8 can be used for the study of antimicrobial resistance[1].

• HY-P5709

  HG4	Inhibitor
  HG4 is a fast-acting antimicrobial peptide. HG4 shows anti-biofilm and anti-inflammatory activities. HG4 is active against Gram-positive pathogens, especially against MRSA strains (MIC: 32-64?μg/mL). HG4 can bind to bacterial lipids and reduces ATP concentration in S. aureus MRSA USA300 cells[1].

• HY-B1386

  Halazone	Inhibitor
  Halazone is an atypical antimicrobial sulfonamide derivative and a carbonic anhydrase II inhibitor with a Kd value of 1.45 µM. Halazone protects sodium channels from inactivation. Halazone is widely used for disinfection of drinking water[1][2].

• HY-B1235R

  Acetohydroxamic acid (Standard)	Inhibitor
  Acetohydroxamic acid (Standard) is the analytical standard of Acetohydroxamic acid. This product is intended for research and analytical applications. Acetohydroxamic acid (AHA) is a potent irreversible bacterial and plant urease inhibitor that can be used to study chronic urinary tract infections.

• HY-P0269A

  Magainin 1 TFA	Inhibitor
  Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria[1][2][3].

• HY-17460AR

  Garenoxacin (Mesylate hydrate) (Standard)	Inhibitor
  ACHE-IN-38 (hydrochloride) (Standard) is the analytical standard of ACHE-IN-38 (hydrochloride). This product is intended for research and analytical applications. ACHE-IN-38 hydrochloride (Compound 13b) inhibits the metabolic breakdown of the neurotransmitter acetylcholine (ACh) by the enzyme acetylcholinesterase (AChE) and hence alleviates memory deficits in patients with Alzheimer’s Disease by potentiating cholinergic transmission[1].

• HY-N6013

  Aloin(mixture of A&B)	Inhibitor	99.91%
  Aloin (mixture of A&B) is anthraquinone derivative isolated from Aloe vera. Aloin (mixture of A&B) has diverse biological activities such as anti-inflammatory, immunity, antidiabetic, antioxidant, antibacterial, antifungal, and antitumor activities. Aloin (mixture of A&B) also an effective inhibitor of stimulated granulocyte matrix metalloproteinases (MMPs)[1][2].

• HY-128384

  Benzyldodecyldimethylammonium chloride dihydrate	Inhibitor
  Benzyldodecyldimethylammonium chloride dihydrate is a quaternary ammonium compound (QAC) and can be used as a biocide to target antibiotic-resistant bacteria, such as methicillin-resistant Staphylococcus aureus (MRSA), multidrug-resistant (MDR) P. aeruginosa et. al. Benzyldodecyldimethylammonium chloride dihydrate, an antimicrobial agent, bacteriostatic or bactericidal properties depending on the concentration.

• HY-N13891

  Arisostatin A	Inhibitor
  Arisostatin A, a microbial secondary metabolite, is an antibiotic against Gram-positive bacteria and shown to possess potent anti-tumor properties. Arisostatin A induces apoptosis through the activation of caspase-3 and reactive oxygen species (ROS) generation in AMC-HN-4 cells[1].

• HY-B1908

  Midecamycin	Inhibitor
  Midecamycin, an acetoxy-substituted macrolide antibiotic, is tested against gram-positive and gram-negative bacteria.

• HY-151631

  MRV03-070	Inhibitor
  MRV03-070 is an inhibitor of colibactin-activating peptidase ClbP with an IC50 value of 69 nM, acts like biosynthetic precursor precolibactin[1].

• HY-W439855

  10-Norparvulenone	Inhibitor
  10-Norparvulenone is an antibiotic that fights against influenza viruses and has antibacterial activity against E. coli[1][2].

• HY-W811579A

  Bensuldazic acid sodium	Inhibitor
  Bensuldazic acid sodium (compound 4f) is a lipophilic 3,5-disubstituted tetrahydro-2H-1,3,5-thiadiazine-2-thione (THTT) derivative that can be used as a prodrug model. Bensuldazic acid has antifungal activity[1].

• HY-W587519

  Bisphenol A bis(3-chloro-2-hydroxypropyl) ether
  Bisphenol A bis(3-chloro-2-hydroxypropyl) ether is an organic compound with potential antimicrobial activity. Bisphenol A bis(3-chloro-2-hydroxypropyl) ether can be widely used in coatings and plastics to improve the strength and durability of materials. Bisphenol A bis(3-chloro-2-hydroxypropyl) ether also plays an important role in textile processing, improving the wrinkle resistance and abrasion resistance of fabrics.

• HY-N0012R

  Glycitin (Standard)	Inhibitor
  Glycitin (Standard) is the analytical standard of Glycitin. This product is intended for research and analytical applications. Glycitin (Glycitein 7-O-β-glucoside) is a natural isoflavone with antibacterial, antiviral, anticancer, anti-inflammation, anti-aging and estrogenic effects. Glycitin may regulate osteoblasts through TGF-β or AKT signaling pathways in bone marrow stem cells (BMSCs)[1][2].

• HY-N1499R

  Nystose (Standard)	Activator
  Nystose (Standard) is the analytical standard of Nystose. This product is intended for research and analytical applications. Nystose is a tetrasaccharide with two fructose molecules linked via beta (1→2) bonds to the fructosyl moiety of sucrose.Nystose exhibits prebiotic, immunomodulatory, and metabolism regulating activities[2].

• HY-146448

  PXYD3	Inhibitor
  PXYD3 is a ribosomal protein S1 (RpsA) antagonist with Kds of 5.66 and 6.91 μM for RpsA-CTD and RpsA-CTD Δ438A, respectively. RpsA plays an important role in the trans-translation process of Mycobacterium Tuberculosis (Mtb)[1].

• HY-170488

  CM-728	Inhibitor
  CM-728 is a oxazepine-naphthoquinone that has cytotoxic and bactericidal effect. CM-728 is a human peroxiredoxin-1 inhibitor. CM-728 is an oxidative stressor that affects mitochondrial function[1].

• HY-W013376

  Norcyclizine	Inhibitor	99.73%
  Norcyclizine is a piperazine compound that can be used for the synthesis of antimicrobial agents. 1-Benzhydrylpiperazine derivatives have been found to enhance the antibacterial activity of β-lactam antibiotics (Oxacillin, HY-B0925A) against Methicillin (HY-121544)-resistant Staphylococcus aureus (MRSA). This enhancement is likely achieved by inhibiting the allosteric site of PBP2a. Additionally, 1-Benzhydrylpiperazine can also serve as a pharmacological scaffold for the synthesis of anticancer agents[1][2].

• HY-B0318S

  Metronidazole-13C2,15N2	Inhibitor	99.30%
  Metronidazole-13C2,15N2 is the 13C-labeled and 15N-labeled Metronidazole. Metronidazole is a nitroimidazole antibiotic medication used particularly for anaerobic bacteria and protozoa.

• HY-156021

  Antitubercular agent-40	Inhibitor
  Antitubercular agent-40 (compound 93) is a thieno[2,3-b]quinoline-2-carboxamide compound with potential antitubercular activity[1].

• HY-W009886

  3,4,5-Trimethoxybenzaldehyde
  3,4,5-Trimethoxybenzaldehyde is an intermediate for the synthesis of various pharmaceuticals, especially for trimethoprim used to research bacterial infections, including urinary tract pathogens infection.

• HY-P4820

  SYNV-cyclo(CGGYF)	Inhibitor
  SYNV-cyclo(CGGYF) is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) inhibits S. aureus activity. SYNV-cyclo(CGGYF) has the potential for the research of S. aureus-mediated epithelial damage and inflammation[1].

• HY-129943

  Benzothiohydrazide	Inhibitor	99.59%
  Benzothiohydrazide is an analogue of anti–tubercular agent Isoniazid. Benzothiohydrazide exhibits anti–tubercular activity, with MICs of 132 μM and 264 μM for M. tuberculosis wild type (H37Rv) and clinical mutant strains (IC1 and IC2)[1].

• HY-17560R

  Demeclocycline (hydrochloride) (Standard)	Inhibitor
  Demeclocycline (hydrochloride) (Standard) is the analytical standard of Demeclocycline (hydrochloride). This product is intended for research and analytical applications.

• HY-N0195R

  Azomycin (Standard)	Inhibitor

• HY-108004

  Decamethoxine	Inhibitor
  Decamethoxine (Septefril) is a cationic gemini surfactant. Decamethoxine exhibits strong bactericidal and fungicidal effects. Decamethoxine modifies the permeability of the microbial cell membrane, resulting in the destruction and death of diverse microorganisms[1][2].

• HY-N7120R

  Penicillin G procaine (hydrate) (Standard)	Inhibitor
  Penicillin G procaine (hydrate) (Standard) is the analytical standard of Penicillin G procaine (hydrate). This product is intended for research and analytical applications. Penicillin G Procaine hydrate (PGP hydrate), a β-lactam antibiotic, is a crystalline complex produced by chemically combining penicillin G with procaine[1][2].

• HY-P5575

  Aurein 3.2	Inhibitor
  Aurein 3.2 is an antibiotic antimicrobial peptide. Aurein 3.2 also has anticancer activity[1].

• HY-N7111R

  Sultamicillin (tosylate) (Standard)	Inhibitor
  Sultamicillin (tosylate) (Standard) is the analytical standard of Sultamicillin (tosylate). This product is intended for research and analytical applications. Sultamicillin tosylate is a broad-spectrum and orally active beta-lactamase inhibitor, an antibiotic with antibacterial activity[1].

• HY-P5492A

  Delta-hemolysin TFA	Inhibitor
  Delta-hemolysin (Delta-lysin) TFA, a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin TFA may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin TFA is a model in the study of peptides interacting with membranes. Delta-hemolysin TFA is poorly active against bacteria[1].

• HY-W353258

  Moxifloxacin hydrochloride monohydrate	Inhibitor
  Moxifloxacin (BAY 12-8039) hydrochloride monohydrate is an orally active bacterial inhibitor that is effective against Streptococcus pneumoniae. Moxifloxacin hydrochloride monohydrate can be used in tuberculosis research[1][2].

• HY-A0153

  Cephapirin	Inhibitor
  Cephapirin (Cefapirin) is an ephalosporin antibiotic with broad-spectrum antimicrobial activity[1][2][3].

• HY-15398S4

  Vitamin D3-13C5	Inhibitor
  Vitamin D3-13C5 is the deuterium labeled Vitamin D3 (HY-15398). Vitamin D3 (Cholecalciferol) is a naturally occuring form of vitamin D. Vitamin D3 induces cell differentiation and prevents proliferation of cancer cells[1][2].

• HY-N11169

  Apigravin	Inhibitor
  Apigravin is a potent antibacterial agent. Apigravin shows antibacterial activity against Bacillus subtilis with a MIC value of 61 μM[1].

• HY-B0330BR

  Levofloxacin (hydrochloride) (Standard)	Inhibitor

• HY-158289

  Isoniazid-KLH	Inhibitor
  Isoniazid-KLH is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-W012126

  2,6-Dichlorodiphenylamine	Inhibitor	99.71%
  2,6-Dichlorodiphenylamine is an analogue of Diclofenac Sodium (HY-15037) and has anti-Candida albicans activity. Diclofenac Sodium is a potent and nonselective anti-inflammatory agent, acts as a COX inhibitor, with IC50s of 4 and 1.3 nM for human COX-1 and COX-2 in CHO cells.

• HY-Y0479S3

  L-Lactic acid-2-13C1	Inhibitor
  L-Lactic acid-2-13C1 is the 13C-labeled L-Lactic acid (HY-Y0479). L-Lactic acid is a buildiing block which can be used as a precursor for the production of the bioplastic polymer poly-lactic acid[1].

• HY-N7101

  Cefpodoxime Proxetil	Inhibitor	98.15%
  Cefpodoxime proxetil is an orally administered broad spectrum third-generation cephalosporin. Cefpodoxime proxetil has anti-bacterial activity. Cefpodoxime proxetil binds to penicillin binding proteins (PBPs) which inhibits peptidoglycan synthesis, finally results in interfering bacterial cell wall biosynthesis[1][2].

• HY-B1150

  Clofoctol	Inhibitor	99.93%
  Clofoctol is a bacteriostatic antibiotic. Clofoctol is used in the treatment of respiratory tract and ear, nose and throat infections caused by Gram-positive bacteria. Clofoctol is only functional against Gram-positive bacteria and can penetrate into human lung tissue. Clofoctol is also an inhibitor of prostate cancer. Clofoctol has antiviral potency[1][2][3].

• HY-B1350R

  Fusidic acid (Standard)	Inhibitor
  Fusidic acid (Standard) is the analytical standard of Fusidic acid. This product is intended for research and analytical applications. Fusidic acid (Fusidate) a bacteriostatic antibiotic produced from the Fusidium coccineum fungus, belongs to the class of steroids. Fusidic acid has no corticosteroid effects. Fusidic acid inhibits the growth of bacteria by preventing the release of translation elongation factor G (EF-G) from the ribosome[1][2].

• HY-D1005A21

  Poloxamer 335 (P105)	Inhibitor
  Poloxamer 335 P105 is block polymer of polyoxyethylene and polyoxypropylene with average molecular mass of 6500. Poloxamer 335 P105 exhibits antimicrobial activity, that inihibits 86% Mycobacterium avium complex at concentration of 1 mg/mL. Poloxamer 334 P104 exhibits muscular toxicity. Poloxamer 334 P104 forms thermoreversible hydrogel, that is utilized in food additives, drug delivery carriers in cosmetics, pharmaceutical ingredients and tissue engineering[1][2][3].

• HY-B0273AR

  Sulfadiazine (sodium) (Standard)	Inhibitor
  Sulfadiazine (sodium) (Standard) is the analytical standard of Sulfadiazine (sodium). This product is intended for research and analytical applications. Sulfadiazine sodium is a sulfonamide?antibiotic with antimalarial activity. Sulfadiazine can be used for toxoplasmosis research[1][2].

• HY-17359

  Deferasirox	Inhibitor	99.65%
  Deferasirox (ICL 670) is an orally available iron chelator used for the management of transfusional iron overload[1][2][3].

• HY-168509

  IMPDH-IN-1	Inhibitor
  IMPDH-IN-1 (compound 44) is a bacterial inosine 5'-monophosphate dehydrogenase (IMPDH) inhibitor. IMPDH-IN-1 specifically binds to the catalytic domain of IMPDH. IMPDH-IN-1 potently inhibits the IMPDH of Pseudomonas aeruginosa, Staphylococcus aureus and Escherichia coli[1].

• HY-N3196

  Neotuberostemonine		99.93%
  Neotuberostemonine, one of the main antitussive alkaloids in the root of Stemona tuberosa Lour, attenuates bleomycin-induced pulmonary fibrosis by suppressing the recruitment and activation of macrophages[1].

• HY-B0474R

  Tetracycline (hydrochloride) (Standard)	Inhibitor
  Tetracycline (hydrochloride) (Standard) is the analytical standard of Tetracycline (hydrochloride). This product is intended for research and analytical applications. Tetracycline (hydrochloride) is a broad-spectrum antibiotic, exhibiting activity against a wide range of gram-positive and gram-negative bacteria.

• HY-P5696

  Xenopsin precursor fragment	Inhibitor
  Xenopsin precursor fragment is an antimicrobial peptide, and has antibacterial/antifungal (10-500 μg/mL) and anti-protozoal (MIC: 2-20 μg/mL) activity[1].

• HY-P5474

  PMAP-23	Inhibitor	99.65%
  PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.)

• HY-12450

  Lomofungin	Inhibitor
  Lomofungin is a novel antibiotic produced by Streptomyces lomondensis sp.N . Lomofungin can inhibit MBNL1-CUG RNA binding. Lomofungin has antibacterial activity[1][2].

• HY-U00058R

  Diflucortolone valerate (Standard)	Inhibitor
  Diflucortolone valerate (Standard) is the analytical standard of Diflucortolone valerate. This product is intended for research and analytical applications. Diflucortolone valerate is a powerful corticosteroid used topically for the research of various skin diseases[1].

• HY-30263

  4-Heptyloxyphenol	Inhibitor	99.44%
  4-Heptyloxyphenol (p-(heptyloxy)phenol) has antibacterial activity agaisnt P. gingivalis, S. artemidis, Str. sobrinus (MIC: 0.10, 0.21, 0.14 mM)[1].

• HY-147866

  Antibacterial agent 110	Inhibitor
  Antibacterial agent 110 (Compound 4e) is a potent antibacterial agent with a MIC value of 1 μg/mL against P. aeruginosa. Antibacterial agent 110 possesses favorable antibiofilm activity and can destroy cell membranes. Antibacterial agent 110 causes metabolic arrest and intracellular oxidative stress, and obstructs DNA replication[1].

• HY-111588

  Xanthoangelol	Inhibitor	99.88%
  Xanthoangelol, extracted from Angelica keiskei, suppresses obesity-induced inflammatory responses. Xanthoangelol possesses antibacterial activity. Xanthoangelol inhibits monoamine oxidases. Xanthoangelol induces apoptosis in neuroblastoma and leukemia cells[1][2][3][4].

• HY-13662R

  Lansoprazole (Standard)	Inhibitor
  Lansoprazole (Standard) is the analytical standard of Lansoprazole. This product is intended for research and analytical applications. Lansoprazole (AG 1749) is an orally active proton pump inhibitor which prevents the stomach from producing acid. Lansoprazole (AG 1749) is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[1][2].

• HY-B1900R

  Methylprednisolone succinate (Standard)		99.73%
  Methylprednisolone succinate (Standard) is the analytical standard of Methylprednisolone succinate. This product is intended for research and analytical applications. Methylprednisolone succinate is a synthetic glucocorticoid and widely used as an anti-inflammatory agent.

• HY-B0698

  Ceftibuten	Inhibitor
  Ceftibuten (Sch39720), an antibiotic, is an orally active cephalosporin, possesses potent activity in vitro against a wide range of gram-negative and certain gram-positive pathogens[1][2].

• HY-P99583

  Suvratoxumab	Inhibitor	98.79%
  Suvratoxumab (MEDI4893) is a long-acting, high-affinity human anti-α-toxin monoclonal antibody (IgG1κ type). Suvratoxumab potently neutralizes α-toxin, a key S. aureus virulence factor. Suvratoxumab improves survival and reduces lung injury in an immunocompromised mice model of pneumonia. Suvratoxumab also enhances the antibacterial activity of Vancomycin (HY-B0671) or Linezolid (HY-10394)[1][2][3].

• HY-168631

  Antibacterial agent 254	Inhibitor
  Antibacterial agent 254 (Compound 2) is a dispersion sensor (DspS) activator that disperses Pseudomonas aeruginosa biofilms. Antibacterial agent 254 can dislodge 7-day P. aeruginosa biofilms at 50 μM. Antibacterial agent 254 also enhances the effects of Ciprofloxacin (HY-B0356) against P. aeruginosa and increases the expression of matrix-degrading enzyme genes pelA, pslG and eddA[1].

• HY-105387

  Heliquinomycin	Inhibitor
  Heliquinomycin is an inhibitor of DNA helicase (Ki: 6.8 μM) and inhibits DNA and RNA synthesis. Heliquinomycin is effective against Gram-positive bacteria strains. Heliquinomycin inhibits cancer cell growth[1][2].

• HY-N0445

  2-Hydroxy-4-methoxybenzaldehyde	Inhibitor	99.97%
  2-hydroxy-4-methoxybenzaldehyde is a potent tyrosinase inhibitor[1]. 2-Hydroxy-4-methoxybenzaldehyde, an isomer of Vanillin, could be used to synthesis Urolithin M7[2]

• HY-N2105

  (-)-Dicentrine	Inhibitor	99.80%
  (-)-Dicentrine is an aporphine alkaloid that can be isolated from the stem bark of Talauma arcabucoana. (-)-Dicentrine shows moderate growth inhibition against Staphylococcus aureus and Candida albicans[1].

• HY-125735

  Sch725674	Inhibitor
  Sch725674 is a macrolide compound with antimicrobial activity against brewer's yeast and Candida albicans, with MICs of 8 and 32 μg/ml[1].

• HY-162028

  GaMF1.39	Inhibitor
  GaMF1.39 is an antimycobacterial compound, targeting the F-ATP synthase subunit γ. GaMF1.39 displays enhanced anti-tuberculosis activity in combination with ETC inhibitors[1].

• HY-154438

  RDR 02308	Inhibitor
  RDR 02308 is a TLR4-MyD88 binding inhibitor that inhibits full-length β-lactamase[1].

• HY-138083

  Parvodicin C2	Inhibitor
  Parvodicin C2 is a glycopeptide antibiotic that can be isolated from parvosata. Parvodicin C2 has antibacterial activity[1].

• HY-N12600

  Thiolopyrrolone A	Inhibitor
  Thiolopyrrolone A (compound 1) exhibits antibacterial activities against BCG, M. tuberculosis and S. aureus with minimum inhibitory concentrations (MIC) of 10, 10 and 100 μg/mL, respectively[1].

• HY-114505

  3-Hydroxypentadecane-4-one	Inhibitor
  3-Hydroxypentadecane-4-one (LAI-1; Legionella autoinducer-1) is a quorum sensing signaling molecule by Legionella pneumophila. 3-Hydroxypentadecane-4-one is an autoinducer, which affects the intercellular communication between bacteria through sensor kinases, LqsS, LqsT and LqsR[1].

• HY-P2313

  Human β-defensin-2	Inhibitor
  Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus[1]. Human β-defensin-2 can be used for the study of colitis[2].

• HY-16770

  Sarecycline	Inhibitor
  Sarecycline is an orally effective narrow-spectrum tetracycline derivative antibiotic. Sarecycline has anti-inflammatory activity. Sarecycline inhibits the activity of Gram-positive bacteria and several types of keratobacterium acnes. Sarecycline interferes with tRNA accommodation and tethers mRNA to the 70S ribosome. Sarecycline can be used to study moderate to severe acne[1][2][3][4][5][6].

• HY-163073

  Anti-MRSA agent 9	Inhibitor
  Anti-MRSA agent 9 (compound 39) shows antibacterial effects against clinically isolated methicillin-resistant Staphylococcus aureus (MRSA) with MIC values of 1 μg/ml. Anti-MRSA agent 9 also shows anti-MRSA efficacy in vivo[1].

• HY-141619A

  Cotrimoxazole (Trimethoprim/sulfamethoxazole 1:19)	Inhibitor	99.87%
  Cotrimoxazole (Trimethoprim/sulfamethoxazole 1:19), an antimicrobial agent, is a Trimethoprim and Sulfamethoxazole mixture. The ratio of Trimethoprim to Sulfamethoxazole in the combination mixture is 1 : 19[1].

• HY-129166

  UCM53	Inhibitor
  UCM53, a FtsZ inhibitor, is an antibacterial agent. UCM53 can inhibit the growth of clinical isolates of antibiotic-resistant Staphylococcus aureus and Enterococcus faecalis[1]

• HY-A0107S

  Tetracycline-d6	Inhibitor
  Tetracycline-d6 is the deuterium labeled Tetracycline. Tetracycline is a broad-spectrum antibiotic, exhibiting activity against a wide range of gram-positive and gram-negative bacteria.

• HY-161300

  Antibacterial agent 191	Inhibitor
  Antibacterial agent 191 (compound 11a) is a potent semi-synthetic antibiotic. Antibacterial agent 191 exhibits preferable metabolic stability[1].

• HY-N7107A

  (+)-Fenchyl alcohol	Inhibitor
  (+)-Fenchyl alcohol is a monoterpene alcohol in the essential oils isolated from Douglas fir needles, acts as a fragrance. (+)-Fenchyl alcohol strongly inhibits the rumen microbial activity of both sheep and deer[1][2].

• HY-16764A

  Acorafloxacin hydrochloride	Inhibitor
  Acorafloxacin hydrochloride (JNJ-Q2 hydrochloride) is a broad-spectrum fluoroquinolone anti-bacterial drug being developed for the treatment of acute bacterial skin and skin-structure infections and community-acquired pneumonia[1]. Acorafloxacin hydrochloride (Avarofloxacin ) is an aminoethylidenylpiperidine fluoroquinolone that demonstrates antibacterial effect against numerous Gram-positive bacteria with a mean 0.12 mg/L MIC90 value[2]. Acorafloxacin hydrochloride (JNJ-Q2) has potential for treatment of methicillin-resistant Staphylococcus aureus (MRSA) infections[3].

• HY-125555

  Azosulfamide	Inhibitor
  Azosulfamide has an anticonvulsant effect and can be used for research of epilepsy. Azosulfamide is active against recurrent tetanus[1][2].

• HY-B0083

  Leflunomide		99.82%
  Leflunomide is a pyrimidine synthesis inhibitor, inhibiting dihydroorotate dehydrogenase (DHODH), and acts as a disease-modifying antirheumatic agent.

• HY-146722

  Antibacterial agent 89	Inhibitor
  Antibacterial agent 89 is a potent antibacterial agent. Antibacterial agent 89 shows anti-clostridial activity. Antibacterial agent 89 inhibits the release of cytotoxins and the β’CH-σ interaction. Antibacterial agent 89 disrupts the process of bacterial transcription[1].

• HY-B2234

  Povidone iodine	Inhibitor
  Povidone iodine (iodopovidone) displays excellent antibacterial activity which can against MRSA and MSSA strains with MICs of 31.25 mg/L and 7.82 mg/L, respectively.

• HY-158279

  Gentamicin/OVA	Inhibitor
  Gentamicin/OVA is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-W002677R

  Fluoroquinolonic acid (Standard)	Inhibitor
  Fluoroquinolonic acid (Standard) is the analytical standard of Fluoroquinolonic acid. This product is intended for research and analytical applications. Fluoroquinolonic acid is a bacteriostatic antibiotic. Fluoroquinolonic acid has broad-spectrum activity against Gram-positive and Gram-negative bacteria[1].

• HY-17628S1

  Cefiderocol-d6	Inhibitor
  Cefiderocol-d6 (S-649266-d6) is a deuterated labeled Cefiderocol (HY-17628). Cefiderocol is a siderophore cephalosporin which has a potent activity against a broad range of aerobic Gram-negative bacterial species with MIC50s of 2 μg/mL or less[1].

• HY-113952R

  Actinonin (Standard)	Inhibitor

• HY-117843

  Ppc-1	Inhibitor
  Ppc-1 is a mitochondrial uncoupler. Ppc-1 enhances mitochondrial oxygen consumption without adverse effects on ATP production. Ppc-1 is a cell-permeate interleukin-2 (IL-2) inhibitor. Ppc-1 inhibits the Gram-negative periodontopathogen Porphyromonas gingivalis. Ppc-1 has anti-obesity, antibacterial and anti-inflammatory activities[1][2][3][4].

• HY-P2289

  β-defesin 1 (pig)	Inhibitor
  β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs[1].

• HY-B0608

  Chlorhexidine (digluconate) (20% in water)	Inhibitor
  Chlorhexidine digluconate is a chlorophenyl biguanide with broad antibacterial action against both Gram (+) and (-) bacteria and fungi. Chlorhexidine digluconate is a broad-spectrum antiseptic and disinfectant. Chlorhexidine digluconate is effective to prevent and control infectious diseases of the mouth by killing bacteria in saliva and tongue. Chlorhexidine digluconate is a cytotoxic agent and induces cell necrosis and apoptosis[1][2][3].

• HY-W590539

  ω-azido-C6 Ceramide	Inhibitor
  ω-azido-C6 Ceramide reduces the membrane potential, and exhibits antibacterial activity against Neisseria, with MIC of 2 µg/ml for N. meningitidis MC58 and N. gonorrhoeae FA1090[1].

• HY-135655

  Fobrepodacin disodium	Inhibitor	99.53%
  Fobrepodacin (SPR720) disodium is an orally active and potent phosphate proagent of SPR719 (VXc-486; HY-12930). Fobrepodacin disodium has potent bactericidal activities in vivo[1].

• HY-147948

  DNA Gyrase-IN-4	Inhibitor
  DNA Gyrase-IN-4 (compound 8p) is a potent DNA gyrase inhibitor, with an IC50 of 0.13 μM. DNA Gyrase-IN-4 shows excellent antibacterial activity against Staphylococcus aureus, Listeria monocytogenes, Salmonella and Escherichia coli, with MIC values of 0.05, 0.05, 0.05, and 8 μg/mL, respectively[1].

• HY-B0975AR

  Penicillin V (Standard)	Inhibitor
  Penicillin V (Standard) is the analytical standard of Penicillin V. This product is intended for research and analytical applications. Penicillin V (Phenoxymethylpenicillin) is a potent and orally active antibiotic. Penicillin V shows antibacterial activity for Streptococci, Clostridium difficile and staphylococcus aureus. Penicillin V has the potential for the research of otitis, sinusitis, pharyngitis and tonsillitis[1][2][3][4].

• HY-141828

  Antibacterial agent 26	Inhibitor	98.07%
  Antibacterial agent 26 is a potent antibacterial compound.

• HY-B1222AR

  Sisomicin (Standard)	Inhibitor
  Sisomicin (Standard) is the analytical standard of Sisomicin. This product is intended for research and analytical applications. Sisomicin is a broad-spectrum aminoglycoside antibiotic produced by Micromonospora inyoensis. Sisomicin is highly active against Gram-positive bacteria[1][2].

• HY-B1690AR

  Methdilazine (hydrochloride) (Standard)	Inhibitor
  Thioridazine (Standard) is the analytical standard of Thioridazine. This product is intended for research and analytical applications. Thioridazine, an antagonist of the dopamine receptor D2 family proteins, exhibits potent anti-psychotic and anti-anxiety activities. Thioridazine is also a potent inhibitor of PI3K-Akt-mTOR signaling pathways with anti-angiogenic effect. Thioridazine shows antiproliferative and apoptosis induction effects in various types of cancer cells, with specificity on targeting cancer stem cells (CSCs)[1][2][3][4].

• HY-109587

  BM635	Inhibitor	99.85%
  BM635 is a MmpL3 inhibitor with outstanding anti-mycobacterial activity. BM635 has an MIC50 of 0.12 μM against M. tuberculosis H37Rv.

• HY-B0400E

  D-Sorbitol, M400 (Excipient)
  D-Sorbitol (Sorbitol), M400 (Excipient) is a D-Sorbitol (HY-B0400) with a granule size of about 400 μm. D-Sorbitol is a six-carbon sugar alcohol and can used as a sugar substitute. D-Sorbitol can be used as a stabilizing excipient and/or isotonicity agent, sweetener, humectant, thickener and dietary supplement. Particle sizes and shapes may induce changes in flow properties[1][2].

• HY-N6626R

  Pyraclostrobin (Standard)	Inhibitor
  Pyraclostrobin (Standard) is the analytical standard of Pyraclostrobin. This product is intended for research and analytical applications. Pyraclostrobin is a highly effective and broad-spectrum strobilurin fungicide. Pyraclostrobin can induce oxidative DNA damage, mitochondrial dysfunction and autophagy through the activation of AMPK/mTOR signaling. Pyraclostrobin can be used to control crop diseases[1][2][3].

• HY-16592R

  Brefeldin A (Standard)

• HY-B1046S

  Clofazimine-d7	Inhibitor
  Clofazimine-d7 is deuterium labeled Clofazimine. Clofazimine is an iminophenazine dye, has a marked anti-inflammatory effect, has been used in combination with other antimycobacterial agents to treat AIDS and Crohn's disease.

• HY-115965R

  VP-4604 (Standard)	Inhibitor

• HY-W015879R

  2-Heptanol (Standard)	Inhibitor

• HY-P4353

  D-{Ala-Ala-Ala}	Inhibitor
  D-{Ala-Ala-Ala} is a tripeptide. D-{Ala-Ala-Ala} binds to ristocetin to detect bacteria at low concentrations[1].

• HY-Y0839S

  Levulinic acid-d5	Inhibitor
  Levulinic acid-d5 is the deuterium labeled Levulinic acid[1]. Levulinic acid is a precursor for the synthesis of biofuels, such as ethyl levulinate[2].

• HY-107064

  Cefroxadine	Inhibitor
  Cefroxadine (CGP 9000) is an orally active cephalosporin antibiotic. Cefroxadine is more effective than cephalexin against Escherichia coli and Klebsiella pneumoniae with MIC values of 3.13 and 1.56 μg/mL respectively with a concentration of 106 μg/mL. Cefroxadine can be used for the research of infection[1].

• HY-B0522A

  Ampicillin sodium	Inhibitor
  Ampicillin sodium (D-(-)-α-Aminobenzylpenicillin sodium salt) is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria[1].

• HY-B1387R

  Sulfamethoxypyridazine (Standard)	Inhibitor
  Sulfamethoxypyridazine (Standard) is the analytical standard of Sulfamethoxypyridazine. This product is intended for research and analytical applications. 0

• HY-N7505

  Norchelerythrine	Inhibitor
  Norchelerythrine is an alkaloid isolated from the roots of Zanthoxylum capense with antibacterial activity against gram-positive and gram-negative bacteria. Norchelerythrine exhibits inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa, and Enterococcus faecalis and Escherichia coli with MIC values >50 µg/mL[1].

• HY-13451

  Finafloxacin	Inhibitor	98.75%
  Finafloxacin is a fluoroquinolone antimicrobial agent that exhibits optimum efficacy in slightly acidic environments.

• HY-161827

  Anti-MRSA agent 14	Inhibitor
  Anti-MRSA agent 14 (Compound C17) has antibacterial agent against MRSA and MRSA-infected skin murine model. Anti-MRSA agent 14 is more potential than Norfloxacin (HY-B0132) against MRSA. Anti-MRSA agent 14 disrupts cell membrane and restrains metabolism. Anti-MRSA agent 14 shows antibacterial effects against S. aureus ATCC 6538, S. aureus ATCC 29213, S. epidermidis ATCC 12228, and MRSA with MIC values of 1, 2, 2, 1 μM respectively[1].

• HY-A0130R

  Sulfalene (Standard)	Inhibitor
  Sulfalene (Standard) is the analytical standard of Sulfalene. This product is intended for research and analytical applications. Sulfalene (Sulfametopyrazine) is an antimalarial agent. Sulfalene is also a long-acting sulfonamide antibacterial.

• HY-135747

  Gut restricted-7	Inhibitor
  Gut restricted-7 (GR-7) is a potent, covalent and orally active pan-bile salt hydrolase (BSH) inhibitor. Gut restricted-7 has a tissue-selective and is restricted to the gut. Gut restricted-7 decreases gut bacterial BSHs and decreases deconjugated bile acid levels in feces of mice[1].

• HY-W019806

  Lacto-N-fucopentaose I	Modulator
  Lacto-N-fucopentaose I (LNFPI) is a human milk oligosaccharide (HMO), possessing antiviral and antibacterial activity. Lacto-N-fucopentaose I can reduce capsid protein VP1 to block virus adsorption, promote CDK2 and reduce cyclin E to recover cell cycle S phase block. Lacto-N-fucopentaose I inhibits ROS production and apoptosis in virus-infected cells. Lacto-N-fucopentaose I can also regulate intestinal microbiota to affect immune system development[1].

• HY-B0334R

  Sulbactam (Standard)	Inhibitor
  Sulbactam (Standard) is the analytical standard of Sulbactam. This product is intended for research and analytical applications. Sulbactam (CP45899) is a competitive, irreversible beta-lactamase inhibitor. Sulbactam shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus--Acinetobacter baumannii (Acb) complex[1][2].

• HY-W587414

  Neospiramycin I	Inhibitor
  Neospiramycin I is a macrolide antibiotic and a derivative of Spiramycin I (HY-N7141). Neospiramycin I is effective against the macrolide-sensitive KB210 strain of S. aureus, but ineffective against the macrolide-resistant KB224 strain, with minimum inhibitory concentrations (MIC) of 3.12 and greater than 100 µg/mL, respectively; it is also effective against B. cereus, B. subtilis, M. luteus, E. coli, and K. pneumoniae, with respective MIC values of 1.56, 3.12, 3.12, 0.2, 50, and 12.5 µg/mL. Neospiramycin I binds to the ribosomes of E. coli, with an inhibitory concentration 50 (IC50) of 1.2 µM. It protects mice from death in a type III S. pneumoniae infection model, with an effective dose 50 (ED50) of 399.8 mg/kg[1][2].

• HY-135470R

  Nifurpirinol (Standard)	Inhibitor

• HY-B0269

  Rifapentine	Inhibitor
  Rifapentine (DL 473) is an antibiotic used in tuberculosis research[1].

• HY-126597

  Chaetoglobosin C	Inhibitor
  Chaetoglobosin C (Compound 4) is a anthraquinone-chromone compound derived from the fungus Chaetomium globosum KMITL-N0802. Chaetoglobosin C has anti-tuberculosis activity [1].

• HY-161397

  NA-1-157	Inhibitor
  NA-1-157 is a potent irreversible covalent inhibitor of the GES-5 carbapenemase, with a MIC of 0.5 μg/mL[1].

• HY-18671

  BoNT-IN-1	Inhibitor	99.17%
  BoNT-IN-1 is an effective inhibitor of botulinum toxin type A light chain (BoNTA LC), with an IC50 value of 0.9 μM.

• HY-14397R

  Indomethacin (Standard)
  Indomethacin (Standard) is the analytical standard of Indomethacin. This product is intended for research and analytical applications. Indomethacin (Indometacin) is a potent, orally active COX1/2 inhibitor with IC50 values of 18 nM and 26 nM for COX-1 and COX-2, respectively. Indomethacin has anticancer activity and anti-infective activity. Indomethacin can be used for cancer, inflammation and viral infection research[1][2][3].

• HY-B0242

  Sulfanilamide	Inhibitor	99.93%
  ulfanilamide (Sulphanilamide) is a potent and orally active sulfonamide antibiotic and can be a major intermediate of sulfamethoxazole biodegradation. Sulfanilamide also is a carbonic anhydrase inhibitor. Sulfanilamide shows inhibition on virus of lymphogranuloma venereum[1][2][3][4].

• HY-P3459

  Tet-213	Inhibitor
  Tet-213 is a antimicrobial peptide. Tet-213 has broad spectrum antibacterial activity. Tet-213 can promote infected wound repair[1].

• HY-B1923A

  Piperacillin hydrate	Inhibitor
  Piperacillin hydrate is a semisynthetic broad-spectrum β-lactam antibiotic which exhibits potent bactericidal activity against Gram-negative bacteria as well as select Gram-positive strains through penicillin-binding proteins. Piperacillin hydrate is most commonly used in combination with the β-lactamase inhibitor Tazobactam (HY-B1418)[1][2][3].

• HY-A0097

  Teicoplanin	Inhibitor
  Teicoplanin is a glycopeptide antibiotic indicated for use in serious infections caused by Gram-positive bacteria, including Methicillin-resistant Staphylococcus aureus and Enterococcus aureus.Teicoplanin shows antiviral activity for HIV-1, SARS-CoV1 and SARS-CoV2. Teicoplanin sodium shows anti-MRSA activity[1][2].

• HY-W009168R

  Tazobactam (sodium) (Standard)	Inhibitor
  Flutianil (Standard) is the analytical standard of Flutianil. This product is intended for research and analytical applications. Flutianil is a fungicide, which specifically inhibits the powdery mildew species. Flutianil inhibits the haustorium formation and subsequent mycelia growth[1].

• HY-155970

  Urease-IN-7	Inhibitor
  Urease-IN-7 (Compound 5k) is a competitive Urease inhibitor (IC50: 3.33 μM, Ki: 3.62 μM). Urease-IN-7 can be used for research of peptic and gastric ulcers[1].

• HY-P5623

  RVG	Inhibitor
  RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells[1].

• HY-169160

  Anti-MRSA agent 18	Inhibitor
  Anti-MRSA agent 18 (E17) is an inhibitor of MRSA with MIC values of 2 μg/mL for S. aureus and 4 μg/mL for MRSA, respectively. Anti-MRSA agent 18 interacts with bacterial cell membrane phosphatidylglycerol and cardiolipin, causing changes in cell membrane permeability and polarization, increased intracellular ROS, and DNA and protein leakage, thereby accelerating bacterial death[1].

• HY-108847

  Etanercept
  Etanercept, a dimeric fusion protein that binds TNF, acts as a TNF inhibitor. Etanercept competitively inhibits the binding of both TNF-α and TNF-β to cell surface TNF receptors, rendering TNF biologically inactive. Etanercept shows efficacy against rheumatoid arthritis, juvenile idiopathic arthritis, and plaque psoriasis[1][2][3].

• HY-N9709

  5-Hydroxysophoranone	Inhibitor
  5-Hydroxysophoranone is a flavanone that can be isolated from the Erythrina subumbrans. 5-Hydroxysophoranone shows weak antibacterial activity against several strains of Streptococcus[1].

• HY-N3192

  Nervogenic acid	Inhibitor
  Nervogenic acid is an aromatic compound that can be isolated from Piper elongatum VAHL. Nervogenic acid has antibacterial activities and antioxidative effects[1].

• HY-142124

  Kalimantacin A	Inhibitor
  Kalimantacin A is a potent antibiotic. Kalimantacin A shows antibacterial activity against staphylococcus including methicillin-resistant staphylococcus aureus (MRSA)[1][2].

• HY-P3326

  Targeting the bacterial sliding clamp peptide 46	Inhibitor
  Targeting the bacterial sliding clamp peptide 46 is a short peptide targeting the bacterial sliding clamp(SC), inhibiting SC-dependent DNA synthesis.

• HY-123614

  PD 140248 hydrochloride	Inhibitor
  PD 140248 hydrochloride is a quinolone broad-spectrum antibacterial agent with good in vitro bacteriostatic activity, especially having a significant inhibitory effect on Gram-positive bacteria[1].

• HY-N0683

  α-Vitamin E	Inhibitor
  α-Vitamin E ((+)-α-Tocopherol), a naturally occurring vitamin E form, is a potent antioxidant[1][2].

• HY-P99649

  Gremubamab	Inhibitor
  Gremubamab (MEDI3902) is a humanized IgG1 kappa anti-PcrV/Psl monoclonal antibody. Gremubamab binds to the PA PcrV protein and Psl exopolysaccharide. Gremubamab has the potential for the research of pseudomonas aeruginosa infections[1][2].

• HY-17021A

  Esomeprazole magnesium salt
  Esomeprazole magnesium salt ((S)-Omeprazole magnesium salt) is a potent and orally active proton pump inhibitor and reduces acid secretion through inhibition of the H+, K+-ATPase in gastric parietal cells. Esomeprazole magnesium salt has the potential for symptomatic gastroesophageal reflux disease research[1][2][3].

• HY-163625

  Mtb-IN-7	Inhibitor
  Mtb-IN-7 (compoun R7) is a MAO-A/MAO-B inhibitor with the IC50 values over 40 μM. Mtb-IN-7 shows antimycobacterial activity against M. tuberculosis H37Rv with the MIC of 2.01 μM[1].

• HY-130838R

  JH-LPH-33 (Standard)	Inhibitor

• HY-B0546

  Procaine		99.95%
  Procaine is a DNA-demethylating agent. Procaine acts through multiple targets and has a slow onset and a short duration of action[1][2].

• HY-N10457

  Norstictic acid	Inhibitor
  Norstictic acid is a potent and selective allossteric transcriptional regulator. Norstictic acid shows anticancer activity. Norstictic acid shows antioxidant activity and antimicrobial activity[1][2][3][4].

• HY-N2301

  Pleuromutilin	Inhibitor
  Pleuromutilin (Drosophilin B) exhibits antibacterial activity through inhibition of protein synthesis[1].

• HY-120435

  Tyrothricin	Inhibitor
  Tyrothricin is a polypeptide antibiotic mixture isolated from Bacillus brevis and consists of tyrocidines and gramicidins. Tyrothricin shows activity against bacteria, fungi and some viruses. Tyrothricin containing formulations are used in sore throat agents and in agents for the healing of infected superficial and small-area wounds[1].

• HY-116815

  Lalistat 1	Inhibitor
  Lalistat 1 is a potent, selective, and competitive inhibitor of lysosomal acid lipase (LAL) and against purified human LAL (phLAL) with an IC50 of 68 nM. Lalistat 1 is a inhibitor of immunoglobulin A1 protease (IgA1P) proteases for H. influenzae, has less effects on other serine hydrolases (trypsin or β-lactamase, etc.). Lalistat 1 can be used for the research of niemann-pick type C (NPC) disease[2].

• HY-B0614

  Mafenide	Inhibitor
  Mafenide is an effective sulfonamide-type antimicrobial agent used for burn wounds. Mafenide shows activity against both Gram-positive and Gram-negative organisms, including Pseudomonas aeruginosa, via inhibition of nucleotide synthesis[1][2].

• HY-P1884

  LL-37, acetylated,amidated	Inhibitor	98.12%
  LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on the N-terminus and amidated on the C-terminus. The single human cathelicidin peptide LL-37 has antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host[1].

• HY-B0919

  Azaserine	Inhibitor
  Azazerine (CI-337) is a competitive inhibitor of glutamine amidotransferase. Azaserine is an antibiotic, it shows antibacterial activities. Azazerine shows anti-tumor activities and it may also act as a tumor inducer. Azazerine can be used for the research of cancer and infection[1][2][3][4][5].

• HY-W015546

  β-N-methylamino-L-alanine hydrochloride	Inhibitor
  β-N-methylamino-L-alanine hydrochloride (BMAA hydrochloride) is a neurotoxin produced by cyanobacteria. β-N-methylamino-L-alanine hydrochloride activates mGluR3 and inhibits PKC. β-N-methylamino-L-alanine hydrochloride can be used in the research of neurodegenerative diseases and immune diseases[1][2][3][4][5][6][7][8][9][10][11][12][13].

• HY-161336

  Alendronate prodrug-1
  Alendronate prodrug-1(compound 2) is an inhibitor of farnesyl diphosphate synthase (FPPS). Alendronate prodrug-1 has an antiproliferative effect with an IC50 value of 34.0 μM[1].

• HY-B0030

  D-Cycloserine	Inhibitor	99.97%
  D-Cycloserine is an antibiotic which targets sequential bacterial cell wall peptidoglycan biosynthesis enzymes. D-Cycloserine is a partial NMDA agonist that can improve cognitive functions. D-Cycloserine can be used for multidrug-resistant tuberculosis research[1][2].

• HY-U00092B

  (R,R)-BAY-Y 3118	Inhibitor
  (R,R)-BAY-Y 3118 is the R-enantiomer of BAY-Y 3118. (R,R)-BAY-Y 3118 shows weak bactericidal activity[1].

• HY-107805

  Dihydroactinidiolide	Inhibitor
  Dihydroactinidiolide, existing in plant leaves and fruits, is a potent plant growth inhibitor, a regulator of gene expression and is responsible for photo acclimation in Arabidopsis. Dihydroactinidiolide has antioxidant activity, antibacterial activity, anticancer activity and neuroprotective effect[1]. Dihydroactinidiolide is also an inhibitor of AChE (IC50=34.03 nM) and has scavenging activities for DPPH and (.NO). Dihydroactinidiolide is present in plant leaves and fruits and is a potent plant growth inhibitor, regulator of gene expression, and responsible for light adaptation in Arabidopsis.

• HY-66011A

  Moxifloxacin	Inhibitor	99.47%
  Moxifloxacin is an orally active 8-methoxyquinolone antimicrobial for use in the treatment of acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1][2].

• HY-116168

  Aldecalmycin	Inhibitor
  Aldecalmycin is an antibiotic showing antimicrobial activities against Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA) with MICs values of 6.25-25 μg/mL[1].

• HY-147814

  KFU-127	Inhibitor
  KFU-127 (Compound 6b) is a broad spectrum topical antimicrobial capable of one-shot targeting of bacterial and fungal-bacterial biofilms. KFU-127 is considerably toxic for eukaryotic cells[1]. KFU-127 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-146400

  Antibacterial agent 97	Inhibitor
  Antibacterial agent 97 (hit compound) is a potent antibacterial agent. Antibacterial agent 97 shows antibacterial activities with MIC of 16 and 16 µg/mL for Escherichia coli (E. coli) and Staphylococcus aureus (S. aureus), respectively[1].

• HY-B1300R

  Cefonicid (sodium) (Standard)	Inhibitor
  Cefonicid (sodium) (Standard) is the analytical standard of Cefonicid (sodium). This product is intended for research and analytical applications. 0

• HY-N0683S6

  α-Vitamin E-d11	Inhibitor
  α-Vitamin E-d11 ((+)-α-Tocopherol-d11) is the deuterium labeled α-Vitamin E (HY-N0683). α-Vitamin E ((+)-α-Tocopherol), a naturally occurring vitamin E form, is a potent antioxidant[1][2].

• HY-N7699C

  D-Pentamannuronic acid	Inhibitor
  D-Pentamannuronic acid, an alginate oligomer, is produced by marine brown algae and by a limited range of Gram negative bacteria. D-Pentamannuronic acid can be used for the research of pain and vascular dementia[1][2][3][4].

• HY-W782391

  Linolenyl alcohol	Inhibitor
  Linolenyl alcohol is an unsaturated alcohol that inhibits Gram-positive bacteria[1][2].

• HY-B0479

  Thiamphenicol	Inhibitor	99.20%
  Thiamphenicol (Thiophenicol), a methyl-sulfonyl derivative of Chloramphenicol, is a broad-spectrum antimicrobial antibiotic. Thiamphenicol acts by binding to the 50S ribosomal subunit, leading to inhibition of protein synthesis and bacteriostatic effect (against Gram-negative, Gram-positive aerobic and anaerobic bacteria)[1][2].

• HY-P10281

  RW3	Inhibitor	98.00%
  RW3 is a small cationic hexapeptide with amphiphilic properties. RW3 targets the plasma membrane of bacteria and works by inhibiting cell respiration and cell wall synthesis. RW3 shows high biological activity against gram-positive bacteria and does not show significant cytotoxic or hemolytic effects in previous studies. RW3 quickly kills 97% of the initial colony forming units (CFU) within 10 minutes at twice the minimum inhibitory concentration (MIC). RW3 can be used in antimicrobial and antifungal studies[1].

• HY-155462

  hERG-IN-1	Inhibitor
  hERG-IN-1 (compound 2a) is an antibacterial agent and inhibitor of hERG. hERG-IN-1 inhibits pulmonary infection caused by Pseudomonas aeruginosa strain ATCC 27853[1].

• HY-N9971

  Hentriacontane	Inhibitor
  Hentriacontane is a long-chain alkane. Hentriacontane exerts anti-inflammatory effects by inhibiting the NF-κB pathway. Hentriacontane has anti-inflammatory, antitumor and antibacterial activities[1].

• HY-145301

  Mycobactin-IN-1	Inhibitor
  Mycobactin-IN-1 (compound 44), a pyrazoline analogue, is a mycobactin biosynthesis inhibitor against mycobacteria. Mycobactin-IN-1 binds to salicyl-AMP ligase (MbtA), a key enzyme in the mycobactin biosynthetic pathway[1].

• HY-129814

  MM 42842 free acid	Inhibitor
  MM 42842 free acid is a member of the monobactam family of β-lactam antibiotics[1].

• HY-17558R

  Apramycin (Standard)	Inhibitor
  Apramycin (Standard) is the analytical standard of Apramycin. This product is intended for research and analytical applications. 0

• HY-A0279AR

  Pristinamycin IA (Standard)	Inhibitor

• HY-A0246AR

  Flucloxacillin sodium (Standard)	Inhibitor
  Flucloxacillin sodium (Standard) is the analytical standard of Flucloxacillin sodium. This product is intended for research and analytical applications. Flucloxacillin sodium is an active antibiotic against gram-positive and gram-negative bacteria[1][2].

• HY-B0958R

  Mupirocin (Standard)	Inhibitor
  Mupirocin (Standard) is the analytical standard of Mupirocin. This product is intended for research and analytical applications. Mupirocin (BRL-4910A, Pseudomonic acid) is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2].

• HY-W023253

  Biclotymol	Inhibitor
  Biclotymol is an antimicrobial agent against gram-positive cocci. Biclotymol inhibits Streptococcus pneumoniae and Haemophilus influenzae, with MIC of 150 and 150 μM. Biclotymol exhibits anti-inflammatory and analgesic activity and ameliorates the otolaryngology infection and throat sore[1].

• HY-145440

  Colistin adjuvant-2	Inhibitor
  Colistin adjuvant-2 is a colistin adjuvant, shows increased colistin potentiation activity against Gram-negative bacteria[1].

• HY-115407

  Cochliodone A	Inhibitor
  Cochliodone A is an active compound extracted from cultures of the deep-sea derived fungus Chaetomium sp. and has antibacterial and anticancer activity. Cochliodone A is toxic to a variety of bacteria, with MICs of 15.3 μg/mL (V. vulnificus), 32.7 μg/mL (V. rotiferianus), 15.9 μg/mL (S. aureus ATCC 43300), and 16.3 μg/mL (S . aureus CGMCC 1.12409). Cochliodone A also inhibits a variety of cancer cell lines, with IC50s of 28.1 μM (A549), 20.7 μM (HeLa), and 23.2 μM (Hep G2)[1].

• HY-W097867

  8-Methoxyciprofloxacin	Inhibitor
  8-Methoxyciprofloxacin (8-Methoxy-cipro) induces DNA cleavage mediated by wild-type gyrase and Quinolone-resistant mutants. 8-Methoxyciprofloxacin can be used for research of drug resistance[1].

• HY-115959

  Anticancer agent 34	Inhibitor
  Anticancer agent 34 (compound 9), a sulfonylurea derivative, is a potent antimicrobial and anticancer agent. Anticancer agent 34 inhibits the microbial growth of B. mycoides, E. coli, and C. albicans with a MIC between 0.156 and 0.039 mg/ml. Anticancer agent 34 inhibits A549, PC3 cell growth with IC50s of 8.4 µg/ml, 7.8 µg/ml, respectively[1].

• HY-138958

  HT1171	Inhibitor
  HT1171 is a potent and selective inhibitor of mycobacterium tuberculosis proteasome. HT1171 shows strong anti-tuberculosis activity against Mycobacterium tuberculosis H37Rv with an MIC90 of 2 μg/mL and an MIC of 4 μg/mL. When HT1171 concentration is 100 μM, the inhibition rate of human normal hepatocytes L02 is 53.8%. HT1171 can be used in the research of antitubercular agent[1][2].

• HY-126699

  Herbimycin C	Inhibitor
  Herbimycin C is a bacterial metabolite originally isolated from S. hygroscopicus. It is cytotoxic to HeLa and Ehrlich cells (IC50s=7.3 and 1.2 μg/mL, respectively).

• HY-P4747

  LL-37 GKE	Inhibitor
  LL-37 GKE is an active domain of LL-37. LL-37 GKE has antibacterial activity and has potential applications in antibiotics[1][2].

• HY-B0441AR

  Tobramycin (sulfate) (Standard)	Inhibitor

• HY-13662S

  Lansoprazole-d4	Inhibitor	99.82%
  Lansoprazole-d4 is a deuterium labeled Lansoprazole. Lansoprazole is a proton pump inhibitor which prevents the stomach from producing acid[1].

• HY-B1920A

  Josamycin hydrochloride
  Josamycin (EN-141) hydrochloride is an orally active macrolide antibiotic exhibiting antimicrobial activity against a wide spectrum of pathogens, such as bacteria. The dissociation constant Kd from ribosome for Josamycin hydrochloride is 5.5 nM[1][2].

• HY-B1174R

  Bekanamycin (Standard)	Inhibitor
  Bekanamycin (Standard) is the analytical standard of Bekanamycin. This product is intended for research and analytical applications. Bekanamycin (Kanamycin B) is an aminoglycoside antibiotic produced by Streptomyces kanamyceticus, against an array of Gram-positive and Gram-negative bacterial strain[1][2].

• HY-N7068

  Mupirocin calcium hydrate	Inhibitor	98.05%
  Mupirocin (BRL-4910A, Pseudomonic acid) calcium hydrate is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin calcium hydrate apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2].

• HY-168117

  HP-101	Inhibitor
  HP-101 is a cell-permeable dual-substrate inhibitor of HPPK with activity against Gram-positive bacteria.[1].

• HY-121300

  Kendomycin	Inhibitor	98.00%
  Kendomycin ((−)-TAN 2162) is a polyketide antibiotic with remarkable antibacterial and cancer cells cytotoxic activities. Kendomycin tends to be bacteriostatic rather than bactericidal and inhibits the growth of the methicillin-resistant Staphylococcus aureus (MRSA) strain COL at a low concentration (MIC of 5 μg/mL). Kendomycin is a potent antagonist of the endothelin receptor and a calcitonin receptor agonist which plays its role as an anti-osteoporotic agent[1][2].

• HY-117837

  GSK1829820A
  GSK1829820A has antitubercular activity which can inhibit Mycobacterium tuberculosis H37Rv[1].

• HY-170575

  Pks13-IN-1	Inhibitor
  Pks13-IN-1 (Compound 44) is an orally active inhibitor for Mycobacterium tuberculosis Polyketide synthase 13 (Pks13). Pks13-IN-1 inhibits M. tuberculosis strain H37Rv with a MIC of 0.07 μM. Pks13-IN-1 exhibits antibacterial efficacy in mouse model[1].

• HY-N11407

  Bagougeramine B	Inhibitor
  Bagougeramine B is an orally active nucleoside antibiotic with antimicrobial activity, which is found in Bacillus circulans. Bagougeramine B inhibits the growth of Gram-positive and Gram-negative bacteria and some fungi[1].

• HY-A0086

  Netilmicin sulfate	Inhibitor
  Netilmicin (sulfate) (SCH-20569 (sulfate)) is an active aminoglycoside antibiotic against most Gram-negative and some Gram-positive bacteria, including certain strains resistant to gentamicin.

• HY-137945

  Phenethicillin sodium	Inhibitor
  Phenethicillin (α-Phenoxyethylpenicillin) sodium is a Penicillin, and has antimicrobial activity[1].

• HY-159170

  Quorum sensing-IN-7	Inhibitor
  Quorum sensing-IN-7 (compound HSL 4) is a potent quorum sensing (QS) inhibitor. Quorum sensing-IN-7 interacts with Leu 72 and Gln 95 in the CviR binding pocket. Quorum sensing-IN-7, an antibacterial agent, is highly effective at inhibiting the production of homoserine lactones (HSLs) and biofilm in C. violaceum at 0.25-1 mg/mL[1].

• HY-105282

  Eremomycin	Inhibitor
  Eremomycin (MM 45289) is a potent glycopeptide antibiotic closely related to Vancomycin (HY-B0671). Eremomycin shows antibacterial activity in Staphylococcus spp. and Bacillus subtilis ATCC6633, with the MIC values of 0.03-1.6 μg/mL[1].

• HY-123711

  PC170942	Inhibitor
  PC170942, a PC58538 analogue, is a potent FtsZ protein inhibitor. PC170942 is a cell division inhibitor, and shows antibacterial activities[1].

• HY-108989

  FMDP
  FMDP is an inhibitor of GlcN-6-P Synthase with an anti-candidal activity. FMDP can be covalently attached to a polyethylene glycol as a nanoparticle shows strong anticancer activity[1].

• HY-W112166A

  4,4'-Dicyanostilbene	Inhibitor
  4,4'-Dicyanostilbene (compound 43) is a potent antimalarial agent against the Dd2 strain, with an EC50 of 27 nM. 4,4'-Dicyanostilbene exhibits in vivo efficacy against methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-B0960

  Sulfabenzamide	Inhibitor	99.68%
  Sulfabenzamide (N-Sulfanilylbenzamide) is an antimicrobial agent and usually consumed in combination with Sulfathiazole and Sulfacetamide. Sulfabenzamide is effective against Gram-positive and negative bacterial strains[1].

• HY-B1894R

  Cefetamet pivoxyl (Standard)	Inhibitor
  Cefetamet pivoxyl (Standard) is the analytical standard of Cefetamet pivoxyl. This product is intended for research and analytical applications. Cefetamet pivoxyl is a cephalosporin antibiotic. Cefetamet pivoxyl inhibits 355 enteropathogens Keime, Gram-negative bacteria (ausgenommen Pseudomonas aeruginosa) and Legionella pneumophila[1].

• HY-B0343R

  Sarafloxacin (Standard)
  Sarafloxacin (Standard) is the analytical standard of Sarafloxacin. This product is intended for research and analytical applications. Sarafloxacin (A-56620) is a fluoroquinolone antimicrobial agent[1].

• HY-126577

  Dactylocycline B	Inhibitor
  Dactylocycline B, an antibiotic, is active against gram-positive bacteria, including tetracycline-resistant bacteria[1].

• HY-121182

  Chalcomycin	Inhibitor
  Chalcomycin is a macrolide antibiotic, which exhibits antimicrobial activities against gram-positive Staphylococcus aureus and Streptococcus pyogenes. Chalcomycin protects mice from infection with a variety of staphylococci and streptococc, without significant toxicity (LD50 >2500 mg/kg)[1].

• HY-127160

  Benzoxonium chloride	Inhibitor	99.73%
  Benzoxonium chloride is an anti-leishmanial agent. Benzoxonium chloride inhibits bacteria, certain protozoa, yeasts and non-spore forming organisms[1].

• HY-W099582

  Myristamidopropyl dimethylamine	Inhibitor
  Myristamidopropyl dimethylamine (MAPD) is an antimicrobial agent (including against bacteria and fungi) and an insecticide, exhibiting inhibitory activity against Pseudomonas aeruginosa, Staphylococcus aureus, Candida albicans, Fusarium solani, and Acanthamoeba polyphaga. Myristamidopropyl dimethylamine can be used in research on microbial-induced keratitis [1].

• HY-U00131

  Sulfabrom	Inhibitor	99.39%
  Sulfabrom (N 3517; Sulfabromomethazine) is a long-acting Sulfonamide that is used for the treatment of coccidiosis and various bacterial infections in the poultry, swine and cattle.

• HY-149064

  Antituberculosis agent-9	Inhibitor
  Antituberculosis agent-9 (Compound 5a) is an orally active antitubercular agent with an MIC of 0.5 μg/mL against H37Ra[1].

• HY-133056

  Pseudomonic acid C	Inhibitor
  Pseudomonic acid C, an antibiotic, possesses antibacterial activity[1].

• HY-161788

  DNA Gyrase-IN-11	Inhibitor
  DNA Gyrase-IN-11 (Compound 23Be) is an inhibitor for protein synthesis (IC50 is 0.74 μM) and DNA replication. DNA Gyrase-IN-11 inhibits DNA gyrase, that inhibits E. coli DNA supercoiling with IC50 of 11.9 μM. DNA Gyrase-IN-11 exhibits antibacterial efficacy, that inhibits Streptococcus pneumoniae, Streptococcus pyogenes, Haemophilus influenzae and Staphylococcus aureus, with MICs of 0.008-0.25 μg/mL[1].

• HY-B1584

  Captan	Inhibitor
  Captan is a common agricultural fungicide used to control Botrytis, Fusarium, Fusicoccum, Pythium. Captan enhances denitrifying and total culturable bacteria[1].

• HY-A0147A

  Grepafloxacin hydrochloride	Inhibitor	99.23%
  Grepafloxacin (OPC-17116) hydrochloride is an oral actively fluoroquinolone antibiotic with potent activity against community-acquired respiratory pathogens including Streptococcus pneumonia. Grepafloxacin hydrochloride has high tissue penetration and a promising pharmacodynamic profile[1][2][3][4].

• HY-W793613

  Drimendiol	Inhibitor
  Drimendiol (compound 1) is an active product that can be isolated from leaves and twigs of D. winterii. Drimendiol shows inhibition for C. albicans, S. aureus, and S. epidermidis biofilm formation with 50% biofilm inhibitory concentration values (BIC50s) of 25.5, 65.1, and 67.1 µg/ml, respectively[1].

• HY-P1539

  Cecropin A	Inhibitor	99.54%
  Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

• HY-168204

  3-Acetyl-28-N-(3-guanidinobutoxy)-oleanolic acid	Inhibitor
  3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid (compound J1) is a potent antimicrobial agent. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid shows anti-gram-positive bacteria and fungi activity. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid can be used as antibiotic adjuvants. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic disrupts the bacterial cell membrane, inserts into the DNA, and binds to DNA gyrase. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic reduces microbial count in a mouse MRSA skin infection model and accelerates wound healing[1].

• HY-117974

  Durlobactam sodium	Inhibitor	99.62%
  Durlobactam sodium salt (ETX2514) is a broad-spectrum β-lactamase inhibitor with IC50s of 4, 14 and 190 nM for Class A KPC-2, Class C AmpC and Class D OXA-24, respectively. For the treatment of drug-resistant Gram-negative bacteria including Acinetobacter baumannii[1].

• HY-N13895

  Auramycin B	Inhibitor
  Auramycin B, an anthracycline antibiotic that shows marked antibacterial activity against Gram-positive bacteria. Auramycin B also exhibits antitumor activity against P388 and L1210 leukemia in mice[1].

• HY-169810

  PKZ18	Inhibitor
  PKZ18 is an antibiotic and inhibits bacterial growth, with MIC values of 32-64 μg/mL against most Gram-positive bacteria. PKZ18 inhibits in vivo transcription and translation of glycyl-tRNA synthetase mRNA. PKZ18 selectively targets stem I specifier loops in Gram-positive bacteria and directly reduces T-box transcriptional read-through of the associated genes. PKZ18 prevents the codon-anticodon reading required for tRNA binding and is refractory to resistance[1][2].

• HY-N2020

  Anacardic Acid	Inhibitor
  Anacardic Acid, extracted from cashew nut shell liquid, is a histone acetyltransferase inhibitor, inhibits HAT activity of p300 and PCAF, with IC50s of ∼8.5 μM and ∼5 μM, respectively.

• HY-160679

  BaENR-IN-1	Inhibitor
  BaENR-IN-1 (Compound 5) is an inhibitor of Enoyl-Acyl Carrier Protein Reductase (ENR) (IC50= 7.7 μM). BaENR-IN-1 blocks the synthesis of fatty acids essential for bacterial growth by inhibiting the bacterial enzyme ENR. BaENR-IN-1 shows activity against bacteria[1].

• HY-W414697

  4-Hydroxysphinganine (C17 base)	Inhibitor
  4-Hydroxysphinganine C17 base (D-Ribo-phytosphingosine C17 base), also known as D-ribo-phytosphingosine or PHS, is a crucial compound present in the membranes of fungi, plants, bacteria, marine organisms, and mammalian tissues. It plays a vital role in preserving the structural integrity of membranes, regulating cellular growth, and mediating the heat stress response in yeast. Additionally, PHS serves as a precursor for the synthesis of important lipid mediators such as PHS 1-phosphate, inositol phosphorylceramide, and KRN7000 (the α-anomer of galactosylceramide). Furthermore, this phospholipid promotes keratinocyte differentiation, making it a valuable active ingredient in cosmetic formulations.

• HY-159899

  DHFR-IN-22	Inhibitor
  DHFR-IN-22 (Compound 8) is a DHFR (Dihydrofolate Reductase) inhibitor belonging to the class of 2,4-diaminopyrimidine compounds. DHFR-IN-22 exhibits significant inhibitory activity against purified DHFR enzyme and major species of nontuberculous mycobacteria (NTM), namely Mycobacterium avium and Mycobacterium abscessus. It shows an IC50 of 1.1 nM and MIC of 1.5 μg/mL against M. abscessus, and an IC50 of 6.3 nM and MIC of 0.1 μg/mL against M. avium. Additionally, it demonstrates an IC50 of 2100 nM against human DHFR. DHFR-IN-22 holds potential for studying novel strategies to combat NTM infections[1].

• HY-W010608

  2-Methyltetrahydrofuran-3-one
  2-Methyltetrahydrofuran-3-one is a quorum sensing inhibitor that can inhibit biofilm formation by H. alvei. 2-Methyltetrahydrofuran-3-one is one of the volatile constituents of roasted coffee[1][2].

• HY-P1687

  Siomycin A	Inhibitor
  Siomycin A is a thiopeptide antibiotic and is a Forkhead box M1(FOXM1) selective inhibitor without affecting other members of the Forkhead box family. Siomycin A has anti-tumor and promotes apoptosis[1][2].

• HY-B0509

  Amikacin hydrate	Inhibitor
  Amikacin hydrate (BAY 41-6551 hydrate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin hydrate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin hydrate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin hydrate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria[1][2].

• HY-16764

  Avarofloxacin	Inhibitor	99.36%
  Avarofloxacin (JNJ-Q2) is a broad-spectrum fluoroquinolone antibacterial agent being developed for the treatment of acute bacterial skin and skin-structure infections and community-acquired pneumonia with oral activity. Avarofloxacin (JNJ-Q2) is an aminoethylidenylpiperidine fluoroquinolone that demonstrates antibacterial effect against numerous Gram-positive bacteria with a mean 0.12 mg/L MIC90 value. Avarofloxacin (JNJ-Q2) has potential for treatment of methicillin-resistant Staphylococcus aureus (MRSA) infections[1][2][3].

• HY-145462

  N-cis-Octadec-9Z-enoyl-L-homoserine lactone
  N-cis-octadec-9Z-enoyl-L-Homoserine lactone is a potent inhibitor of AhyI. AhyI (expressing acylhomoserine lactone) is responsible for the biosynthesis of autoinducer-1 (AI-1), commonly referred to as a quorum sensing (QS) signaling molecule, which plays an essential role in bacterial communication. N-cis-octadec-9Z-enoyl-L-Homoserine lactone is a competitive inhibitor of AI-1 biosynthesis[1].

• HY-B1894AR

  Cefetamet pivoxil (hydrochloride) (Standard)	Inhibitor

• HY-N2980

  Ocotillone	Inhibitor
  Ocotillone ((24S)-20,24-Epoxy-25-hydroxydammaran-3-one) is a triterpenoids that can be isolated from the fruits of Dysoxylum richii. Ocotillone has antibacterial activities against P. aeruginosa and S. typhimurium without hemolytic activity[1].

• HY-170489

  Antifungal agent 123	Inhibitor
  Antifungal agent 123 (Compound 4b) exhibits good affinity to the oxidoreductase of Staphylococcus aureus or the membrane protein of Candida albicans, exhibits antibacterial and antifungal activities. Antifungal agent 123 scavenges free radical, exhibits antioxidant efficacy. Antifungal agent 123 inhibits the TLR signaling pathway, and exhibits anti-inflammatory efficacy[1].

• HY-B0975S1

  Penicillin V-d5 potassium		98.10%
  Penicillin V-d5 (potassium) is the deuterium labeled Penicillin V Potassium[1]. Penicillin V Potassium (Phenoxymethylpenicillin potassium salt) is an orally active antibiotic. Penicillin V Potassium inhibits the growth of Streptococci, C. difficile and S. aureus. Penicillin V Potassium can be used for the research of otitis, sinusitis, pharyngitis and tonsillitis[2][3][4][5].

• HY-B0957S

  Erythromycin ethylsuccinate-13C,d3	Inhibitor
  Erythromycin ethylsuccinate-13C,d3 is the 13C- and deuterium labeled Erythromycin Ethylsuccinate. Erythromycin Ethylsuccinate is an antibiotic useful for the treatment of a number of bacterial infections, has an antimicrobial spectrum similar to or slightly wider than that of penicillin. Erythromycin Ethylsuccinate has antiviral activity against HIV-1.

• HY-P4301

  Di-aspartic acid
  Di-aspartic acid (Aspartylaspartate) can be utilized as growth substrate for P. gingivalis, P. intermedia, P. nigrescens and F. nucleatum[1].

• HY-N6810R

  Thymol (Standard)	Inhibitor
  Thymol (Standard) is the analytical standard of Thymol. This product is intended for research and analytical applications. Thymol is a TRPA1 agonist. Thymol induces cancer cell apoptosis. Thymol is the main monoterpene phenol occurring in essential oils isolated from plants belonging to the Lamiaceae family, and other plants such as those belonging to the Verbenaceae, Scrophulariaceae, Ranunculaceae and Apiaceae families. Thymol has antioxidant, anti-inflammatory, antibacterial and antifungal effects[1].

• HY-148790

  Pralurbactam	Inhibitor
  Pralurbactam is a β-Lactamase inhibitor. Pralurbactam can be used for research of bacterial infection[1][2].

• HY-15739R

  Ansamitocin P-3 (Standard)	Inhibitor

• HY-117260

  Coformycin	Inhibitor
  Coformycin, a nucleoside antibiotic, is a potent inhibitor of adenosine deaminase (ADA) from Streptomyces species. Coformycin possesses anti-tumor and anti-bacterial activity[1][2].

• HY-NP020

  E.coli DH-5 alpha Bacterial protein	Inhibitor
  E.coli DH-5 alpha Bacterial protein is a purified native protein from E.coli DH-5 alpha bacterial[1].

• HY-P99953

  Rivabazumab
  Rivabazumab is a recombinant antibody against Pseudomonas aeruginosa pcrV[1].

• HY-144261

  Metallo-β-lactamase-IN-3	Inhibitor
  Metallo-β-lactamase-IN-3 (compound 35) is a potent metallo-β-lactamases (MBL) inhibitor. Metallo-β-lactamase-IN-3 shows high activity against VIM-1 and NDM-1, with IC50 of 0.6 and 1.0 μM, respectively. Metallo-β-lactamase-IN-3 does not show inhibition of IMP-7[1].

• HY-151626

  MRV03-037	Inhibitor
  MRV03-037 is a selective colibactin-activated peptidase (ClbP) inhibitor that blocks the genotoxic effect of Colibactin (HY-145930) on eukaryotic cells. MRV03-037 prevents gut bacterial genotoxin production[1].

• HY-115965

  VP-4604	Inhibitor	99.20%
  VP-4604 is a potent anti-methicillin-resistant Staphylococcus aureus (MRSA) agent. VP-4604 exhibits significant microbial growth inhibition toward Staphylococcus aureus (ATCC 43300) with MIC of 4-8 µg/mL. VP-4604 inhibits the growth of methicillin‐resistant Staphylococcus aureus with growth inhibition >95%[1].

• HY-W016867

  4-Chlorosalicylic acid	Inhibitor
  4-Chlorosalicylic acid is a pharmaceutical intermediate. Inhibits monophenolase and diphenolase activity with IC50s of 1.89 mM and 1.10 mM. Potent antimicrobial activity. Against E. coli with the MIC of 250 μg/mL and with the MBC of 500 μg/mL.

• HY-139750

  Antibacterial agent 34	Inhibitor
  Antibacterial agent 35, an antibacterial agent, significantly lowers MIC value of antibacterial agent Ceftazidime[1].

• HY-N3528

  Camaric acid	Inhibitor
  Camaric acid can be isolated from the root of Lantana montevidensis and has antibacterial activity[1].

• HY-76260

  Faropenem sodium	Inhibitor	98.87%
  Faropenem sodium is an orally bioavailable penem antibiotic. Faropenem sodium regulates inorganic phosphate transporter Npt1. Faropenem sodium inhibits M. tuberculosis (MIC of 1.3 μg/mL) and B. anthracis[1][2].

• HY-B0330DS

  (R)-Ofloxacin-d3	Inhibitor
  (R)-Ofloxacin-d3 is the deuterium labeled (R)-Ofloxacin. (R)-Ofloxacin (Dextrofloxacin) is an antibiotic useful for the treatment of a number of bacterial infections[1]. Antibacterial activity[1].

• HY-N3075R

  Phytol (Standard)	Inhibitor

• HY-157043

  Antibacterial agent 161 trifluoromethanesulfonate	Inhibitor
  Antibacterial agent 161 trifluoromethanesulfonate (Compound 6) has antibacterial activity. Antibacterial agent 161 trifluoromethanesulfonate has high antiproliferative effects against colon cancer and non-small cell lung cancer[1].

• HY-B0946R

  Sulfamonomethoxine (Standard)	Inhibitor
  Sulfamonomethoxine (Standard) is the analytical standard of Sulfamonomethoxine. This product is intended for research and analytical applications. Sulfamonomethoxine is a long acting sulfonamide antibacterial agent, used in blood kinetic studies,and blocks the synthesis of folic acid by inhibiting synthetase of dihydropteroate.

• HY-N10280

  Asperglaucin A	Inhibitor
  Asperglaucin A represents an unusual phthalide-like derivative. Asperglaucin A exhibits potent antibacterial activities against two plant pathogens Pseudomonas syringae pv actinidae (Psa) and Bacillus cereus, with an MIC value of 6.25 μM[1].

• HY-B0133

  Natamycin		99.07%
  Natamycin (Pimaricin) is a macrolide antibiotic agent produced by several Streptomyces strains. Natamycin inhibits the growth of fungi via inhibition of amino acid and glucose transport across the plasma membrane. Natamycin is a food preservative, an antifungal agent in agriculture, and is widely used for fungal keratitis research[1][2].

• HY-P2458

  CAP18 (rabbit)	Inhibitor
  CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research[1].

• HY-N6670R

  Cefotetan (Standard)	Inhibitor
  Cefotetan (Standard) is the analytical standard of Cefotetan. This product is intended for research and analytical applications. Cefotetan is a semisynthetic cephamycin antibiotic that exerts its bactericidal effects by inhibition of cell-wall synthesis[1].

• HY-B0965

  Thioridazine hydrochloride	Inhibitor	99.96%
  Thioridazine hydrochloride, an orally active antagonist of the dopamine receptor D2 family proteins, exhibits potent anti-psychotic and anti-anxiety activities. Thioridazine hydrochloride is also a potent inhibitor of PI3K-Akt-mTOR signaling pathways with anti-angiogenic effect. Thioridazine hydrochloride shows antiproliferative and apoptosis induction effects in various types of cancer cells, with specificity on targeting cancer stem cells (CSCs)[1][2][3][4].

• HY-B0798

  Cefpiramide sodium	Inhibitor	98.47%
  Cefpiramide sodium (SM-1652; Wy-44635) is a new Pseudomonas-active cephalosporin with a broad spectrum of antibacterial activity.

• HY-121560

  L-leucyldoxorubicin
  L-leucyldoxorubicin (Leurubicin) is a promising Top II inhibitor that holds potential for research in bacterial infections.

• HY-B1595

  Cefmetazole	Inhibitor
  Cefmetazole (CS 1170) is a semisynthetic cephamycin antibiotic with broad-spectrum antibacterial activity, covering gram-positive, gram-negative and anaerobic bacteria. Cefmetazole binds to penicillin binding proteins (PBPs), resulting in interfering bacterial cell wall biosynthesis. Cefmetazole is used for the research of gynecologic, intraabdominal, urinary tract, respiratory tract and skin and soft tissue infections[1][2][3].

• HY-129493

  Lateropyrone	Inhibitor
  Lateropyrone is a type of pyranone antibiotic that can inhibit Gram-negative bacteria, and it's a secondary metabolite produced by the oat fungal pathogen[1].

• HY-B2196

  Gastric mucin	Inhibitor
  Gastric mucin is a large glycoprotein which is thought to play a major role in the protection of the gastrointestinal tract from acid, proteases, pathogenic microorganisms, and mechanical trauma.

• HY-N14937

  Albaflavenone	Inhibitor
  Albaflavenone is a sesquiterpene antibiotic with a zizaene skeleton. Albaflavenone is active against Bacillus subtilis[1].

• HY-B1805

  Triclocarban	Inhibitor	99.00%
  Triclocarban (3,4,4′-Trichlorocarbanilide), a broad spectrum antibacterial compound, is widely used in a broad range of applications such as the production of soaps, skin creams, toothpastes and deodorants. Triclocarban is a potential endocrine-disrupting chemical with the capacity to modulate androgen and estrogen activities as well as other hormone-mediated biological processes[1][2][3].

• HY-N7095

  Ceftezole	Inhibitor
  Ceftezole (CTZ) is a broad-spectrum cephem antibiotic against many species of gram-positive and gram-negative bacteria. Ceftezole (CTZ) is an alpha-glucosidase inhibitor with in vivo anti-diabetic activity[1][2].

• HY-W101673

  Dipropofol	Inhibitor
  Dipropofol is an antioxidant agent[1].

• HY-120536

  HPi1	Inhibitor
  HPi1 is a potent, selective and orally active antimicrobial against Helicobacter pylori with an IC50 of 0.24 μM and an MIC of 0.08-0.16 μg/mL. HPi1 is inactive against other bacteria, including the gut commensals Lactobacillus casei, Lactobacillus reuteri, and Bifidobacterium longum[1].

• HY-111190

  Thiotropocin	Inhibitor
  Thiotropocin is a tropothione Antibiotic with antibacterial activities against Gram-positive and Gram-negative bacteria, some phytopathogens and mycoplasma. Thiotropocin causes morphological changes of Proteus mirabilis and Escherichia coli[1].

• HY-P5659

  Brevinin-1	Inhibitor
  Brevinin-1 is an antimicrobial peptide derived from the skin secretions of Rana esculenta[1].

• HY-P99214

  Panobacumab	Inhibitor	98.24%
  Panobacumab (KBPA101) is a fully human IgM/κ monoclonal antibody generated by immortalizing human B lymphocytes against the LPS O polysaccharide of serotype O11 of P. aeruginosa[1].

• HY-P5634

  Bombinin-like peptide 3	Inhibitor
  Bombinin-like peptide 3 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis[1].

• HY-15310

  Ivermectin
  Ivermectin (MK-933) is a broad-spectrum anti-parasite agent. Ivermectin (MK-933) is a specific inhibitor of Impα/β1-mediated nuclear import and has potent antiviral activity towards both HIV-1 and dengue virus. It is a positive allosteric effector of P2X4 and the α7 neuronal nicotinic acetylcholine receptor (nAChRs). Ivermectin also inhibits bovine herpesvirus1 (BoHV-1) replication and inhibits BoHV-1 DNA polymerase nuclear import[1][2][3][4]. Ivermectin is a candidate therapeutic against SARS-CoV-2/COVID-19[5].

• HY-142097

  Glicophenone	Inhibitor
  Glicophenone is an antibacterial agent with MICs of both 32 μg/mL against MRSA OM481, MRSA OM505, MRSA OM584, MRSA OM623 and MSSA 209P[1].

• HY-B0221

  Amphotericin B
  Amphotericin B is a polyene antifungal agent against a wide variety of fungal pathogens. It binds irreversibly to ergosterol, resulting in disruption of membrane integrity and ultimately cell death.

• HY-162139

  Urease-IN-11	Inhibitor
  Urease-IN-11 (Compound 6e) is a competitive urease inhibitor (IC50)=10.41 µM). Urease-IN-11 can be used to study diseases such as urease-related gastritis and peptic ulcer[1].

• HY-N0565A

  Doxycycline hydrochloride	Inhibitor	99.99%
  Doxycycline hydrochloride, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline hydrochloride shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-A0241

  Dalfopristin	Inhibitor	99.67%
  Dalfopristin (RP54476) is a semisynthetic sulfone antibiotic. Dalfopristin alone has limited antibacterial activity, but synergistically with Quinupristin it has significant bactericidal activity against many pathogenic Gram-positive cocci[1].

• HY-14289A

  Cimetidine hydrochloride
  Cimetidine (SKF-92334) hydrochloride is an orally active and inverse histamine H2 receptor antagonist with a Ki of 0.6 μM. Cimetidine hydrochloride is a gastric acid reducer, and can be used for duodenal and gastric ulcers research. Cimetidine hydrochloride has anti-cancer and anti-inflammatory activity[1][2][5].

• HY-15733

  Lucidin	Inhibitor	98.03%
  Lucidin (NSC 30546) is a natural component of madder and can induce mutations in bacterial and mammalian cells.

• HY-146133

  LA-Bac8c	Inhibitor
  LA-Bac8c is a Lipoic acid modified antimicrobial peptide with enhanced antimicrobial properties. LA-Bac8c inhibits S. aureus, MRSA, S. epidermidis, E. coli, and P. aeruginosa with MICs of 1, 4, 8, 8, and 8 μg/mL[1].

• HY-162861

  3-Methyl-chuangxinmycin	Inhibitor
  3-Methyl-chuangxinmycin is an antibiotic. 3-Methyl-chuangxinmycin can affect the translation process in bacteria and mammalian cells by inhibiting the enzyme that synthesizes tryptophan tRNA (TrpRS). 3-Methyl-chuangxinmycin can downregulate genes related to interferon, TNF, and inflammatory responses in RDEB_L1 cells[1].

• HY-170760

  Antibacterial agent 258	Inhibitor
  Antibacterial agent 258 (Compound 11e) is an antibacterial agent, that destory the bacteria cell membrane, and inhibits various gram-positive bacteria (MIC for Staphylococcus aureus is 1-2 μg/mL). Antibacterial agent 258 exhibits low hemolytic activity and low cytotoxicity. Antibacterial agent 258 exhibits anti-infectious efficacy in mouse models[1].

• HY-155047

  BDM91514	Inhibitor
  BDM91514 improves antibiotic potency through AcrB inhibition. BDM91514 prevents the growth of E. coliBW25113 (EC90: 8 μM) in the presence of 8 μg/mL Pyridomycin. BDM91514 has suitable plasma and microsomal stability[1].

• HY-P10027A

  Clovibactin TFA	Inhibitor
  Clovibactin TFA is the TFA salt form of Clovibactin (HY-P10027). Clovibactin TFA is an antibiotic for drug-resistant bacterial pathogens without detectable resistance. Clovibactin TFA inihibits cell wall synthesis by targeting pyrophosphate of peptidoglycan precursors[1].

• HY-B1123

  Auranofin	Inhibitor
  Auranofin (SKF-39162) is a thioredoxin reductase (TrxR) inhibitor with an IC50 of 0.2 μM. Auranofin exhibits antiviral activity against SARS-CoV21, with a CC50 of 4.2 μM for monkey kidney Vero E6 cells.

• HY-14762

  Besifloxacin	Antagonist
  Besifloxacin is a fluoroquinolone antimicrobial agent. Besifloxacin can inhibit cytokine production by monocytes. Besifloxacin has broad-spectrum antibacterial activity[1].

• HY-125919

  Vulpinic acid	Inhibitor	99.62%
  Vulpinic acid, a lichen metabolite, decreases H2O2-induced ROS production, oxidative stress and oxidative stress-related damages in human umbilical vein endothelial cells (HUVEC). Vulpinic acid is active against staphylococci, enterococci, and anaerobic bacteria.Vulpinic acid has the potential for atherosclerosis research[1][2].

• HY-156198

  Bottromycin A2	Inhibitor
  Bottromycin A2 is a natural antibiotic. Bottromycin A2 is active against methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococci (VRE)[1].

• HY-B0067A

  Amrubicin hydrochloride
  Amrubicin (SM-5887) hydrochloride is a DNA topoisomerase II inhibitor, used for the research of cancer.

• HY-W015026S

  Isobutylparaben-d4
  Isobutylparaben-d4 is the deuterium labeled Isobutylparaben[1]. Isobutylparaben (Isobutyl 4-hydroxybenzoate) is a constitutive androstane receptor (CAR) activator. Isobutylparaben has a broad-spectrum antimicrobial activity and widely used in personal care products and cosmetics[2].

• HY-B1316

  Trimetozine	Inhibitor	99.73%
  Trimetozine is an orally active sedative. Trimetozine has mild tranquilizing effects. Trimetozine can be used for the research of anxiety[1][2][3].

• HY-14289AR

  Cimetidine (hydrochloride) (Standard)
  Cimetidine (hydrochloride) (Standard) is the analytical standard of Cimetidine (hydrochloride). This product is intended for research and analytical applications. Cimetidine (SKF-92334) hydrochloride is an orally active and inverse histamine H2 receptor antagonist with a Ki of 0.6 μM. Cimetidine hydrochloride is a gastric acid reducer, and can be used for duodenal and gastric ulcers research. Cimetidine hydrochloride has anti-cancer and anti-inflammatory activity[1][2][5].

• HY-77813

  Benzyl isothiocyanate	Inhibitor	99.62%
  Benzyl isothiocyanate is an orally available isothiocyanate with bactericidal, anticancer, antiangiogenic and anthelmintic activities. Benzyl isothiocyanate exerts anticancer functions by regulating multiple signaling pathways, including apoptosis, cell proliferation, cell cycle arrest, metastasis, angiogenesis, and autophagy. In addition, Benzyl isothiocyanate can enhance muscle insulin sensitivity to improve obesity-induced hyperglycemia[1][2][3][4][5][6][7][8][9].

• HY-B0502AS1

  Enrofloxacin-d5 hydriodide	Inhibitor
  Enrofloxacin-d5 (hydriodide) is the deuterium labeled Enrofloxacin (monohydrochloride). Enrofloxacin monohydrochloride (BAY Vp 2674 monohydrochloride) is an effective antibiotic with an MIC90 of 0.312 μg/mL for Mycoplasma bovis.

• HY-B0289S

  Erdosteine-13C4	Inhibitor
  Erdosteine-13C4 is a 13C-labeled Erdosteine. Erdosteine inhibits lipopolysaccharide (LPS)-induced NF-κB activation[1][2]. Erdosteine has muco-modulatory, anti-bacterial, anti-inflammatory and anti-oxidant effects[3].

• HY-147876

  Antimicrobial agent-3	Inhibitor
  Antimicrobial agent-3 (Compound U10) is an antimicrobial agent against bacterial, fungal and tubercular infections[1].

• HY-B2006S

  Fenvalerate-d5	Inhibitor
  Fenvalerate-d5 is the deuterium labeled Fenvalerate. Fenvalerate is a potent protein phosphatase 2B (calcineurin) inhibitor with an IC50 of 2-4 nM for PP2B-Aα. Fenvalerate is a pyrethroid ester insecticide and acaricide[1].

• HY-119881

  Alafosfalin	Inhibitor	99.70%
  Alafosfalin is an inhibitor of cell wall biosynthesis. Alafosfalin is a phosphonodipeptide with antibacterial properties[1].

• HY-15278R

  Epothilone D (Standard)	Inhibitor
  Rebaudioside E (Standard) is the analytical standard of Rebaudioside E. This product is intended for research and analytical applications. Rebaudioside E is a steviol glycoside isolated from Stevia rebaudiana leaves[1].

• HY-100760S

  Toxoflavin-13C4	Inhibitor
  Toxoflavin-13C4 is the 13C-labeled Toxoflavin. Toxoflavin (Xanthothricin) is an antagonist of transcription factor 4 (TCF4)/β-catenin complex, also acts as an inhibitor of KDM4A, with antitumor activity[1][2]. Antibiotic properties.

• HY-157141

  Antibacterial agent 163	Inhibitor
  Antibacterial agent 163 (compound 1), a hydroxyquinoline derivative, is a potent bacterial inhibitor. Antibacterial agent 163 inhibits methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-B1300

  Cefonicid sodium	Inhibitor	98.02%
  Cefonicid sodium is a broadspectrum cephalosporin antibiotic which inhibits the formation of the bacterial cell wall.

• HY-Y0366S1

  Lauric acid-d23	Inhibitor
  Lauric acid-d233 is the deuterium labeled Lauric acid. Lauric acid is a middle chain-free fatty acid with strong bactericidal properties. The EC50s for P. acnes, S.aureus, S. epidermidis, are 2, 6, 4 μg/mL, respectively.

• HY-B1256AR

  Cefuroxime (Standard)	Inhibitor
  Cefuroxime (Standard) is the analytical standard of Cefuroxime. This product is intended for research and analytical applications. Cefuroxime is an orally active second-generation cephalosporin antibiotic with increased stability to β-lactamase. Cefuroxime has a broad spectrum activity against Gram-positive and Gram-negative bacteria[1].

• HY-N13958

  Arylomycin A4	Inhibitor
  Arylomycin A4 is a lipohexapeptide antibiotic against Gram-positive bacteria[1].

• HY-125042

  Sarothralin G	Inhibitor
  Sarothralin G is an antibacterial compound isolated from Hypericum japonicum Thunb. (Japanese spurfle). The structure of Sarothralin G contains phenolic and aromatic acid moieties and shows excellent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus, Bacillus subtilis and Nocardia spp., which is stronger than Sarothralen A, B and Saroaspidin A, B, C. Sarothralin G exhibits significant antibacterial potential.

• HY-B1173R

  (+)-Camphor (Standard)	Inhibitor
  (+)-Camphor (Standard) is the analytical standard of (+)-Camphor. This product is intended for research and analytical applications. (+)-Camphor is a food additive used medicinally as a preservative.

• HY-107784

  Ectoine		99.34%
  Ectoine is a natural cell protectant, an amino acid derivate produced by bacteria living under extremely harsh environmental conditions. Ectoine serves as an osmoregulatory compatible solute, increasing the hydration of the skin surface and stabilizing lipid layers, which is useful in skincare. Ectoine demonstrates a good safety profile for the treatment of allergic rhinitis[1][2].

• HY-156256

  Insecticidal agent 4	Inhibitor
  Insecticidal agent 4 (compound IA-8) is an aryl isoxazoline derivative with insecticidal activity against M. separate[1].

• HY-N0525

  Ethyl gallate	Inhibitor	99.93%
  Ethyl gallate is a nonflavonoid phenolic compound and also a scavenger of hydrogen peroxide.

• HY-117166

  Naftoxate
  Naftoxate is an ester compound containing aminomethylsulfate, and its ammonium salt analog can inhibit free thiols to chemically weaken the reactive oxygen species (ROS)-sensitive anaerobic bacterium Trichomonas vaginalis and inhibit common pathogens causing vaginal infections: Candida albicans and Staphylococcus aureus[1].

• HY-17422A

  Acyclovir sodium	Inhibitor
  Acyclovir (Aciclovir) sodium is a potent, orally active antiviral agent. Acyclovir sodium has antiherpetic activity with IC50 values of 0.85 μM and 0.86 μM for HSV-1 and HSV-2, respectively. Acyclovir sodium induces cell cycle perturbation and apoptosis. Acyclovir sodium prevents bacterial infections during induction therapy for acute leukaemia[1][2][3][4].

• HY-153090

  Transketolase-IN-4	Inhibitor	99.59%
  Transketolase-IN-4 is a potent transketolase inhibitor (IC50=3.9 μM). Transketolase-IN-4 inhibits tumor cell proliferation of SW620, LS174T, and MIA PaCa-2. Transketolase-IN-4 is a possible Mycobacterium tuberculosis DXS inhibitor, with an IC50 value of 114.1 μM[1][2].

• HY-N0017R

  Bergenin (Standard)	Inhibitor
  Bergenin (Standard) is the analytical standard of Bergenin. This product is intended for research and analytical applications. Bergenin is a cytoprotective and antioxidative polyphenol found in many medicinal plants. Bergenin has a wide spectrum activities such as hepatoprotective, antiinflammatory, immunomodulatory, antitumor, antiviral, and antifungal properties[1][2].

• HY-106526

  Xibornol	Inhibitor
  Xibornol (Bactacine) has strong antibacterial action against Streptococcus pneumoniae, Streptococcus pyogenes, and Staphyloccus aureus, as well as against Actinomyces israelii and Corynebacterium ulcerans. Xibornol has the potential for using for the antisepsis of the oral cavity and as adjuvant in pharyngeal infections caused by Gram-positive microorganisms[1].

• HY-129124

  β-​Solamarine	Inhibitor
  β-?Solamarine is an antibacterial agent[1].

• HY-P3916

  GVLSNVIGYLKKLGTGALNAVLKQ	Inhibitor
  GVLSNVIGYLKKLGTGALNAVLKQ is an antimicrobial peptide with 24-amino acid. GVLSNVIGYLKKLGTGALNAVLKQ can potentially form α-helix. GVLSNVIGYLKKLGTGALNAVLKQ (PGQ) has activity against Gram-negative, Gram-positive bacteria and the yeast Candida albicans[1].

• HY-B0537AS

  Pentamidine-d4 dihydrochloride	Inhibitor
  Pentamidine-d4 (dihydrochloride) is the deuterium labeled Pentamidine dihydrochloride. Pentamidine dihydrochloride (MP-601205 dihydrochloride) is an antimicrobial agent and interferes with DNA biosynthetics. Pentamidine dihydrochloride inhibits parasite Leishmania infantum with an IC50 of 2.5 μM. Pentamidine dihydrochloride is a potent and selective protein tyrosine phosphatases (PTPases) and phosphatase of regenerating liver (PRL) inhibitor. Pentamidine dihydrochloride has the potential for Gambian trypanosomiasis, antimony-resistant leishmaniasis, and Pneumocystis carinii pneumonia treatment. Antitumor and antibacterial activities[1][2][3][4].

• HY-B1852R

  Sulfometuron-methyl (Standard)	Inhibitor
  Sulfometuron-methyl (Standard) is the analytical standard of Sulfometuron-methyl. This product is intended for research and analytical applications. Sulfometuron-methyl is a herbicide and also a powerful inhibitor of the enzyme acetolactate synthase (ALS). It exhibits antibacterial and antifungal activities, capable of inhibiting the activity of Salmonella. typhimurium ALS II and Escherichia. coli ALS III[1].

• HY-P5633

  Bombinin-like peptide 2	Inhibitor
  Bombinin-like peptide 2 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis[1].

• HY-162430

  Antibacterial agent 206	Inhibitor
  Antibacterial agent 206 (Compound 10e) is a indolylacryloyl-derived oxacins, which exhibits broad antibacterial spectrum with MIC of 0.25-1 μg/mL. Antibacterial agent 206 reduces the exopolysaccharide, eliminates the biofilm, and thus attenuates the drug resistance. Antibacterial agent 206 exhibits antibacterial activity through destory of membrane integrity, accumulation of reactive oxygen species ROS, and inhibition of DNA replication[1].

• HY-B0425R

  Novobiocin (Standard)	Inhibitor
  Novobiocin (Standard) is the analytical standard of Novobiocin. This product is intended for research and analytical applications. Novobiocin (Albamycin) is a potent and orally active antibiotic. Novobiocin also is a DNA gyrase inhibitor and a heat shock protein 90 (Hsp90) antagonist. Novobiocin has the potential for the research of highly beta-lactam-resistant pneumococcal infections. Novobiocin shows anti-orthopoxvirus activity[1][2][3][4][6].

• HY-P5689

  Maximin 42	Inhibitor
  Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells[1].

• HY-B0693A

  Ranitidine bismuth citrate	Inhibitor
  Ranitidine bismuth citrate is an orally active Histamine H2-receptor antagonist with an IC50 of 3.3 μM. Ranitidine bismuth citrate has high selectivity for SARS-CoV-2-infected cells. Ranitidine bismuth citrate is a commonly used agent anti-Helicobacter pylori infection with an MIC90 value of 16 ng/L[1][2][3].

• HY-P2073

  Cyclo(δ-Ala-L-Val)
  Cyclo(Δ-Ala-L-Val) is a cyclic dipeptide and a putative quinolone signal (QS) molecule produced by Pseudomonas aeruginosa[1].

• HY-155715

  G43	Inhibitor	99.76%
  G43 is a potent, selective glucosyltransferase inhibitor, with the Kd of 3.7μM and 46.9 nM for GtfB and GtfC, respectively. G43 has antibacterial to S. mutans in vitro and in vivo, and can be used for dental caries study[1][2].

• HY-B0133R

  Natamycin (Standard)
  Natamycin (Standard) is the analytical standard of Natamycin. This product is intended for research and analytical applications. Natamycin (Pimaricin) is a macrolide antibiotic agent produced by several Streptomyces strains. Natamycin inhibits the growth of fungi via inhibition of amino acid and glucose transport across the plasma membrane. Natamycin is a food preservative, an antifungal agent in agriculture, and is widely used for fungal keratitis research[1][2].

• HY-U00058

  Diflucortolone valerate	Inhibitor
  Diflucortolone valerate is a powerful corticosteroid used topically for the research of various skin diseases[1].

• HY-121544A

  Methicillin sodium hydrate	Inhibitor
  Methicillin sodium hydrate is a narrow-spectrum β-lactam antibiotic, acts by inhibiting penicillin-binding proteins (PBPs). Methicillin sodium hydrate is active against Staphylococcus aureus and Staphylococcus epidermidis that are resistant to other penicillins. Methicillin sodium hydrate can be used for the research of skin infections, osteomyelitis, and endocarditis[1].

• HY-14865R

  Omadacycline (Standard)	Inhibitor
  Omadacycline (Standard) is the analytical standard of Omadacycline. This product is intended for research and analytical applications. Omadacycline (PTK 0796), a first-in-class orally active aminomethylcycline antibacterial, is a member of the tetracycline class of antibiotics. Omadacycline acts through the inhibition of bacterial protein synthesis by binding to the 30S ribosomal subunit. Omadacycline possesses broad-spectrum antibacterial activity against aerobic and anaerobic Gram-positive and Gram-negative bacteria, as well as atypical bacteria. Omadacycline can be used for the research of acute bacterial skin and skin-structure infections, community-acquired pneumonia, and urinary tract infections[1][2][3][4].

• HY-136666

  Antibiotic AC4437	Inhibitor
  Antibiotic AC4437 is a compound with antimicrobial activity isolated from specific soil microorganisms and has an inhibitory effect on Bacillus subtilis.

• HY-W039454R

  2,4-Dichlorobenzyl alcohol (Standard)	Inhibitor
  2,4-Dichlorobenzyl alcohol (Standard) is the analytical standard of 2,4-Dichlorobenzyl alcohol. This product is intended for research and analytical applications. 2,4-Dichlorobenzyl alcohol is a mild antiseptic, with a broad spectrum for bacterial and virus associated with mouth and throat infections[1].

• HY-N7102R

  Ceftiofur (Standard)	Inhibitor
  Ceftiofur (Standard) is the analytical standard of Ceftiofur. This product is intended for research and analytical applications. Ceftiofur is a semisynthetic antibiotic, with activity against various gram-positive and gram-negative, aerobic and anaerobic bacteria encountered by domestic animals[1].

• HY-B1050

  Gemifloxacin mesylate	Inhibitor	99.76%
  Gemifloxacin mesylate (SB-265805S; LB-20304a) is an orally active broad-spectrum quinolone antibacterial antibiotic. Gemifloxacin mesylate inhibits DNA synthesis by inhibiting DNA gyrase and Topoisomerase IV activities. Gemifloxacin mesylate has potent antibacterial activities against gram-positive bacteria in vitro efficacy study, particularly Streptococci and Staphylococci. Gemifloxacin mesylate has been used in the research of respiratory tract infections[1][2][3].

• HY-B0395A

  Sitafloxacin hydrochloride	Inhibitor
  Sitafloxacin (DU6859a) hydrochloride is a potent, orally active fluoroquinolone antibiotic. Sitafloxacin hydrochloride shows antichlamydial activity and antibacterial activities against a broad range of gram-positive and gram-negative bacteria, including anaerobic bacteria, as well as against atypical pathogens. Sitafloxacin hydrochloride can be used for the research of respiratory tract infection and urinary tract infection[1][2].

• HY-P10362

  Temporin-GHd	Inhibitor
  Temporin-GHd exhibits antibacterial activity against Streptococcus mutans (MIC=13.1 μM; MBC=26 μM). Temporin-GHd increases the permeability of the bacterial cell membrane, causing membrane damage and leakage of cellular contents. Temporin-GHd disrupts preformed biofilms at high concentrations. Temporin-GHd can bind to bacterial DNA, inhibiting DNA migration[1].

• HY-B0593AR

  Ceftazidime (pentahydrate) (Standard)	Inhibitor
  Ceftazidime (pentahydrate) (Standard) is the analytical standard of Ceftazidime (pentahydrate). This product is intended for research and analytical applications. Ceftazidime (GR20263) pentahydrate , an antibiotic, has a broad spectrum activity against Gram-positive and Gram-negative aerobic bacteria. Ceftazidime pentahydrate is also active against Enterobacteriaceae (including β-lactamase-positive strains) and is resistant to hydrolysis by most β-lactamases[1].

• HY-W012267

  2-Bromo-2'-methoxyacetophenone	Inhibitor
  2-Bromo-2'-methoxyacetophenone is an irreversible inhibitor for MurA, that inhibits MurA in E. coli with an IC50 of 0.38 μM. 2-Bromo-2'-methoxyacetophenone can be used in antibacterial research for blocking bacterial cell wall synthesis[1].

• HY-10211

  Tanespimycin	Inhibitor
  Tanespimycin (17-AAG) is a potent HSP90 inhibitor with an IC50 of 5 nM, having a 100-fold higher binding affinity for tumour cell derived HSP90 than normal cell derived HSP90[1][5]. Tanespimycin depletes cellular STK38/NDR1 and reduces STK38 kinase activity. Tanespimycin also downregulates the stk38 gene expression[3].

• HY-146446

  PXYC1	Inhibitor	98.98%
  PXYC1 is a ribosomal protein S1 (RpsA) antagonist with Kds of 0.81 and 0.31 μM for RpsA-CTD and RpsA-CTD Δ438A, respectively. RpsA plays an important role in the trans-translation process of Mycobacterium Tuberculosis (Mtb)[1].

• HY-N1394S1

  p-Anisic acid-d4
  p-Anisic acid-d4 is the deuterium labeled p-Anisic acid[1]. p-Anisic acid (4-Methoxybenzoic acid) is one of the isomers of anisic acid, with anti-bacterial and antiseptic properties[2].

• HY-N12264

  Burnettramic acid A	Inhibitor
  Burnettramic acid A is an antibiotic, which can be isolated from Aspergillus burnettii. Burnettramic acid A exhibits antibacterial and antifungal activities, with IC50 of 0.2, 0.5, 2.3 and 5.9 μg/mL, for Saccharomyces cerevisiae, Candida albicans, Bacillus subtilis and Staphylococcus aureus, respectively. Burnettramic acid A exhibits cytotoxicity in cancer cell NS-1 with IC50 of 13.8 μg/mL[1].

• HY-B1599R

  Chloramphenicol palmitate (Standard)	Inhibitor
  Chloramphenicol palmitate (Standard) is the analytical standard of Chloramphenicol palmitate. This product is intended for research and analytical applications. Chloramphenicol palmitate is an orally active broad spectrum antibiotic and has a broad spectrum of activity against gram positive and gram negative bacteria. Chloramphenicol palmitate inhibits bacterial protein synthesis by blocking the peptidyl transferase step. Chloramphenicol palmitate can be used as bacterial selection agent in transformed cells containing chloramphenicol resistance genes[1].

• HY-162595

  BDM88855	Inhibitor
  BDM88855 is an allosteric inhibitor for the homolog AcrB protein. BDM88855 can boost the antibacterial effect of a panel of antibiotics (eg: Oxacillin (HY-B0925A), Linezolid (HY-10394), Novobiocin (HY-B0425), etc.) on wild-type E. coli[1][2].

• HY-P2124R

  Cyclo(L-Trp-L-Trp) (Standard)	Inhibitor
  L-Isoleucine (Standard) is the analytical standard of L-Isoleucine. This product is intended for research and analytical applications. L-Isoleucine is an orally active branched chain amino acid, which is the L-enantiomer of isoleucine. L-Isoleucine has a role as a Saccharomyces cerevisiae metabolite, an Escherichia coli metabolite, a plant metabolite, a human metabolite, an algal metabolite and a mouse metabolite. L-Isoleucine regulates the inflammatory response to protect against pathogens in vivo and in vitro[1].

• HY-N0528

  Linarin	Inhibitor
  Linarin (Buddleoside) is an orally active and selective inhibitor of acetylcholinesterase (AChE). Linarin has many activities, such as anti-inflammatory, antioxidant, sleep aid and sedation, bone differentiation, anti-tumor, antibacterial and antiviral. Linarin can be used to study diseases such as the nervous system, osteoporosis and cancer[1][2][3][4].

• HY-N2181

  Acetylshikonin	Inhibitor	99.39%
  Acetylshikonin is an oral active anti-cancer, anti-inflammatory, antioxidant, anti-fertility, antibacterial, and neuroprotective agent. Acetylshikonin is a inhibitor of acetylcholinase (AChE) (IC50=34.6 μM) and nonselective cytochrome P450. Acetylshikonin can induce Apoptosis and Autophagy in cancer cells. Acetylshikonin regulates blood glucose, liver fat metabolism, and renal fibrosis, and is used in the study of diabetes, diabetic nephropathy (DN), obesity, and nonalcoholic fatty liver disease (NAFLD)[1][2][3][4][5][6][7][8][9].

• HY-B1923R

  Piperacillin (Standard)
  Piperacillin (Standard) is the analytical standard of Piperacillin. This product is intended for research and analytical applications. Piperacillin is a semisynthetic broad-spectrum β-lactam antibiotic which exhibits potent bactericidal activity against Gram-negative bacteria as well as select Gram-positive strains through penicillin-binding proteins. Piperacillin is most commonly used in combination with the β-lactamase inhibitor Tazobactam[1][2][3].

• HY-123286

  (E)-Triandrin	Inhibitor
  (E)-Triandrin (Sachaliside 1) is a natural phenylpropanoid compound[1].

• HY-N3831

  Epimedokoreanin B	Inhibitor
  Epimedokoreanin B is a natural flavonoid with anticancer, anti-inflammatory and antibacterial effects. Epimedokoreanin B inhibits the growth of lung cancer cells through endoplasmic reticulum stress-mediated apoptosis accompanied by autophagosome accumulation. Epimedokoreanin B is an anti-periodontitis agent that inhibits gingipains and Porphyromonas gingivalis growth and biofilm formation[1][2][3].

• HY-124796

  Qstatin	Inhibitor
  QStatin is a potent and selective inhibitor of SmcR (V. harveyi LuxR homologue) with an EC50 of 208.9 nM, binding tightly to SmcR and changes the flexibility of the protein, thereby altering its transcription regulatory activity. QStatin shows pan-QS (Vibrio quorum sensing) inhibitor activity in diverse Vibrio species and attenuates their virulence in an aquatic host. QStatin may be a sustainable antivibriosis agent useful in aquacultures[1].

• HY-P1674A

  Murepavadin TFA	Inhibitor	99.83%
  Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance[1][2].

• HY-B0958

  Mupirocin	Inhibitor	98.04%
  Mupirocin (BRL-4910A, Pseudomonic acid) is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2].

• HY-W083373

  (E)-3,4-Dimethoxychalcone	Inhibitor
  (E)-3,4-Dimethoxychalcone is an isoform of 3,4-Dimethoxychalcone (HY-W083373A), a potential antimicrobial and antioxidant agent.

• HY-14879BR

  Avibactam (sodium hydrate) (Standard)	Inhibitor

• HY-B0105R

  Ketoconazole (Standard)
  Ketoconazole (Standard) is the analytical standard of Ketoconazole. This product is intended for research and analytical applications. Ketoconazole (R-41400) is an imidazole anti-fungal agent, a CYP3A4 and CYP24A1 inhibitor.

• HY-W010649R

  Isoxazole (Standard)	Inhibitor
  Amfenac (Sodium Hydrate) (Standard) is the analytical standard of Amfenac (Sodium Hydrate). This product is intended for research and analytical applications. Amfenac Sodium Hydrate is a COX-2 inhibitor.

• HY-N0709S1

  Coumarin-d6	Inhibitor
  Coumarin-d6 is deuterated labeled trans-2-Undecenal (HY-W127505). Trans-2-UndecenalIt is an organic compound belonging to aldehydes. It has a strong, pungent smell and is commonly found in a variety of foods, including fruits and vegetables. Trans-2-UndecenalIt has a variety of applications in the flavor and fragrance industry, especially as a fragrance agent in products such as perfume, cologne and air fresheners. In addition, it can also be used as an intermediate in the synthesis of various chemicals and drugs.

• HY-P2038

  Cephabacin M6	Inhibitor
  Cephabacin M6 is a cephalosporin component, a 7-methoxydesacetylcephalosporin. Cephabacin M6 can be isolated from the culture filtrate of Xanthomonas lactamica.

• HY-N6908R

  Continentalic acid (Standard)	Inhibitor
  Continentalic acid (Standard) is the analytical standard of Continentalic acid. This product is intended for research and analytical applications. Continentalic acid from Aralia continentalis has minimum inhibitory concentrations (MICs) of approximately 8-16 μg/mL against S. aureus, including the Methicillin (HY-121544) susceptible Staphylococcus aureus (MSSA) and Methicillin-resistant Staphylococcus aureus (MRSA) standard strains[1].

• HY-114798

  Rabelomycin	Inhibitor
  Rabelomycin is antibiotic, which exhibits antimicrobial activity against gram positive bacteria. Rabelomycin exhibits inhibitory activity against inducible nitric oxide synthase (iNOS) with an IC50 of 63.9 μM[1][2].

• HY-B0507R

  Sulfathiazole (Standard)	Inhibitor
  Sulfathiazole (Standard) is the analytical standard of Sulfathiazole. This product is intended for research and analytical applications. Sulfathiazole, an organosulfur compound, is used as a short-acting sulfonamide antibiotic[1][2][3].

• HY-163437

  Antitubercular agent-45	Inhibitor
  Antitubercular agent-45 (Compound 5g) is an antifungal and antitubercular agent. Antitubercular agent-45 inhibits S. aureus, MRSA, B. subtilis, E. coli, C. albicans with MIC values of 6.4, 10.8, 6.1, 8.4 , 8.1 μM respectively[1].

• HY-N9343

  Kulactone	Inhibitor	98.25%
  Kulactone, a natural bioflavonoid and an inhibitor against jRdRp, possesses antifungal, antibacterial and antiplasmodial activities. Kulactone exhibit no crossing through Blood Brain Barrier (BBB)[1][2].

• HY-B0959

  Chloramine-T	Inhibitor
  Chloramine-T is a titrimetric reagent, and an oxidizing agent. Chloramine-T is an oxidizing biocide[1][2].

• HY-N3491

  Isodictamnine	Inhibitor
  Isodictamnine is a phototoxic furoquinoline compound of the Turnipaceae family. Isodictamnine is phototoxic to certain bacteria and yeasts under long-wave UV light[1].

• HY-17021S2

  Esomeprazole-d3 potassium
  Esomeprazole-d3 potassium is deuterated labeled Esomeprazole (HY-17021). Esomeprazole ((S)-Omeprazole) is a potent and orally active proton pump inhibitor and reduces acid secretion through inhibition of the H+, K+-ATPase in gastric parietal cells. Esomeprazole has the potential for symptomatic gastroesophageal reflux disease research[1][2][3].

• HY-B0271

  Pyrazinamide	Inhibitor
  Pyrazinamide (Pyrazinecarboxamide; Pyrazinoic acid amide) is a potent and orally active antitubercular antibiotic. Pyrazinamide is a proagent that is converted to the active form pyrazinoic acid (POA) by PZase/nicotinamidase encoded by the pncA gene in M. tuberculosis.

• HY-B0467C

  Amoxicillin arginine	Inhibitor
  Amoxicillin (Amoxycillin) arginine is an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin arginine inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth[1][2][3].

• HY-155716

  G43-C3-TEG	Inhibitor
  G43-C3-TEG is a glycosyl-transferase inhibitor. G43-C3-TEG reduces the biofilm formation by decreasing the production of EPS (extracellular polysaccharides)[1].

• HY-N6711A

  epi-Equisetin	Inhibitor
  epi-Equisetin, a secondary metabolite, has antibacterial activity[1].

• HY-131907

  LpxC-IN-5	Inhibitor
  LpxC-IN-5 is a potent non-hydroxamate LpxC (UDP-3-O-acyl-N-acetylglucosamine deacetylase) inhibitor with an IC50 of 20 nM. LpxC-IN-5 shows antibacterial activity against E. coli ATCC25922, P. aeruginosa ATCC27853, K. pneumoniae ATCC13883 and P. aeruginosa 5567 with MIC of 16, 4, 64, and 4 μg/mL, respectively[1].

• HY-170688

  Antibacterial agent 119	Inhibitor
  Antibacterial agent 119 (Compound 21 g) is an antibacterial candidate against Methicillin (HY-121544)-resistant Staphylococcus aureus (MICs less than 1 μg/mL against tested strains). Antibacterial agent 119 induces ROS production. Antibacterial agent 119 also acts on the bacterial cell membrane to cause membrane breakage. Antibacterial agent 119 exhibits potent antibacterial activity with low cytotoxicity, rapid bactericidal ability, and good in vivo antibacterial activity[1].

• HY-16745A

  Lascufloxacin hydrochloride	Inhibitor
  Lascufloxacin (KRP-AM1977) hydrochloride is a potent antibacterial compound candidate with broad-spectrum activity against various clinical isolates. Lascufloxacin hydrochloride shows the most potent activity against Gram-positive bacteria compared to other tested quinolones. Lascufloxacin hydrochloride demonstrates incomplete cross-resistance against existing quinolone-resistant strains. Lascufloxacin hydrochloride has potent inhibitory activity against both wild-type and mutated target enzymes.

• HY-B0221A

  Amphotericin B trihydrate
  Amphotericin B trihydrate, a polyene antibiotic, is first isolated from fermenter cultures of Streptomyces nodosus. Amphotericin B trihydrate also possesses antileishmanial activity[1][2].

• HY-P1938R

  Cyclo(L-Pro-L-Val) (Standard)	Inhibitor

• HY-169079

  RNAP-NusG-IN-1	Inhibitor
  RNAP-NusG-IN-1 is an RNAP-NusG inhibitor. RNAP-NusG-IN-1 has antibacterial activity against Gram-positive bacteria, with the strongest activity against Streptococcus pneumoniae, showing an MIC value of 1 μg/mL[1].

• HY-B0364A

  Dyclonine hydrochloride	Inhibitor	99.86%
  Dyclonine (Dyclocaine) hydrochloride is an orally effective ALDH covalent inhibitor (crosses blood-brain barrier), with an IC50 of 35 μM for ALDH2 and 76 μM for ALDH3A1. Dyclonine hydrochloride has sensitizing activities for targeted cancer cells and antibacterial. Dyclonine hydrochloride is also a local agent that can suppress or relieve pain. that blocks the transmission of various nerve impulses or stimuli and inhibits the sensation of touch and pain[1][2][3].

• HY-N0414

  Trigonelline	Inhibitor	99.98%
  Trigonelline is an alkaloid with potential antidiabetic activity that can be isolated from Trigonella foenum-graecum L or Leonurus artemisia. Trigonelline is a potent Nrf2 inhibitor that blocks Nrf2-dependent proteasome activity, thereby enhancing apoptosis in pancreatic cancer cells. Trigonelline also has anti-HSV-1, antibacterial, and antifungal activity and induces ferroptosis.

• HY-P5682

  Maximin 41	Inhibitor
  Maximin 41 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus (MIC: 75 μg/mL). Maximin 41 has hemolytic activities against human red cells[1].

• HY-N1944

  Nerolidol	Inhibitor
  Nerolidol has multiple natural membrane activities, possesses anti-cancer, anti-inflammatory, antibacterial and anti-insect activity. Nerolidol Suppresses parasitic activity, suppresses bloodsucking diseases, bloodworm diseases, and other diseases. Nerolidol can protect the cells from lipid and protein properties, damage to DNA, and protect the cells from damage[1][2][3].

• HY-120203

  DA 1131	Inhibitor
  DA 1131 is an anionic Carbapenem antibiotic. DA 1131 has broad spectrum antibacterial activity for both gram-positive and gram-negative organisms. DA 1131 is resistant to degradation by various types of β-lactamases[1].

• HY-N6810

  Thymol	Inhibitor	99.97%
  Thymol is a TRPA1 agonist. Thymol induces cancer cell apoptosis. Thymol is the main monoterpene phenol occurring in essential oils isolated from plants belonging to the Lamiaceae family, and other plants such as those belonging to the Verbenaceae, Scrophulariaceae, Ranunculaceae and Apiaceae families. Thymol has antioxidant, anti-inflammatory, antibacterial and antifungal effects[1].

• HY-124789R

  TBT1 (Standard)	Inhibitor

• HY-17580R

  Fidaxomicin (Standard)	Inhibitor
  Fidaxomicin (Standard) is the analytical standard of Fidaxomicin. This product is intended for research and analytical applications. Fidaxomicin (OPT-80), a macrocyclic antibiotic, is an orally active and potent RNA polymerase inhibitor. Fidaxomicin has a narrow spectrum of antibacterial activity and a good anti-Clostridium difficile activity (MIC90=0.12 μg/mL). Fidaxomicin can be used for Clostridium difficile infection (CDI) research[1][2][3].

• HY-109000A

  Afabicin disodium	Inhibitor
  Afabicin (Debio 1450) is the proagent of Debio1452, specifically targeting staphylococci without significant activity against other Gram-positive or Gram-negative species. Debio1452 is an inhibitor FabI, an enzyme critical to fatty acid biosynthesis in staphylococci[1].

• HY-139887

  Antibacterial agent 63	Inhibitor
  Antibacterial agent 63, a conjugate of aztreonam to a siderophore mimetic, shows activity against gram-negative bacteria.

• HY-151944

  Antibacterial agent 128	Inhibitor
  Antibacterial agent 128 is a siderophore analog-Ciprofloxacin (Ciprofloxacin (HY-B0356)) conjugate with a cleavable linker. Antibacterial agent 128 shows antibiotic activities against P. aeruginosa (MIC values of 0.25-64 μg/mL) and B. pseudomallei (MIC values of 1-32 μg/mL)[1].

• HY-B0400AS

  L-Sorbitol-13C
  L-Sorbitol-13C is the 13C labeled L-Sorbitol[1].

• HY-A0111A

  Cefetamet sodium
  Cefetamet sodium is a cephalosporin antibiotic. Cefetamet sodium has the potential for the research of both upper and lower community-acquired respiratory tract infections[1].

• HY-Y1093

  Ethyl acetoacetate
  Ethyl acetoacetate (Ethyl acetylacetate) is an ester widely used as an intermediate in the synthesis of many varieties of compounds[1][2][3]. Ethyl acetoacetate is an inhibitor of bacterial biofilm[4].

• HY-P5461

  CHRG01	Inhibitor
  CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)

• HY-B1610

  Sodium citrate dihydrate	Inhibitor
  Sodium citrate dehydrate (Trisodium citrate dihydrate) is a natural product with oral activity that can be found in citrus fruits. Sodium citrate dehydrate can inhibit the proliferation of tumor cells and induce apoptosis. Sodium citrate dehydrate has antibacterial, anti-tumor and antioxidant activities. Sodium citrate dehydrate can be prepared as a cosolvent or buffer[1][2][3].

• HY-124301

  Penicolinate A
  Penicolinate A is a picolinic acid derivative. Penicolinate A is isolated from endophytic Penicillium sp. BCC16054. Penicolinate A exhibits antimalarial and antitubercular activities[1].

• HY-16752R

  Relebactam (Standard)	Inhibitor
  Relebactam (Standard) is the analytical standard of Relebactam. This product is intended for research and analytical applications. Relebactam is a diazabicyclooctane inhibitor with activity against a wide spectrum of β-lactamases, including class A (extended-spectrum β-lactamases and KPC) and class C (AmpC) enzymes. Relebactam shows antibacterial activity[1].

• HY-112624

  Dextran
  Dextran (Dextran 40) has an inhibitory effect on thrombocyte aggregation and coagulation factors and is used as a plasma volume expander.

• HY-B0364AS

  Dyclonine-d9 hydrochloride	Inhibitor
  Dyclonine-d9 (hydrochloride) is deuterium labeled Dyclonine (hydrochloride). Dyclonine hydrochloride (Dyclocaine hydrochloride) is an effective component of Runhou tablets. Dyclonine hydrochloride has significant bactericidal and fungicidal activity[1][2].

• HY-B0220F

  Erythromycin (glutamate)	Inhibitor
  Erythromycin glutamate is a macrolide antibiotic produced by actinomycete Streptomyces erythreus with a broad spectrum of antimicrobial activity. Erythromycin glutamate binds to bacterial 50S ribosomal subunits and inhibits RNA-dependent protein synthesis by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid[1][2]. Erythromycin glutamate also exhibits antitumor and neuroprotective effect in different fields of research[3][4].

• HY-N0565C

  Doxycycline calcium	Inhibitor
  Doxycycline calcium, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline calcium shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-B0502A

  Enrofloxacin monohydrochloride	Inhibitor	98.94%
  Enrofloxacin monohydrochloride (BAY Vp 2674 monohydrochloride) is an effective antibiotic with an MIC90 of 0.312 μg/mL for Mycoplasma bovis. Enrofloxacin monohydrochloride shows inhibitory activity against vaccinia virus (VV).

• HY-19915A

  Contezolid acefosamil	Inhibitor
  Contezolid acefosamil (MRX-4) is the orally active proagent of the active antimicrobial metabolite Contezolid (MRX-I), an oxazolidinone which shows potent in vitro activity against various multidrug-resistant Gram-positive bacteria, including MRSA[1].

• HY-P5492

  Delta-hemolysin	Inhibitor	99.43%
  Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin is a model in the study of peptides interacting with membranes. Delta-hemolysin is poorly active against bacteria[1].

• HY-N2026AR

  Propylparaben (sodium) (Standard)	Inhibitor
  Propylparaben (sodium) (Standard) is the analytical standard of Propylparaben (sodium). This product is intended for research and analytical applications. Propylparaben sodium (Propyl parahydroxybenzoate) is an antimicrobial preservative which can be produced naturally by plants and bacteria. Propylparaben sodium is prevalently used in cosmetics, pharmaceuticals, and foods. Propylparaben sodium disrupts antral follicle growth and steroidogenic function by altering the cell-cycle, apoptosis, and steroidogenesis pathways. Propylparaben sodium also decreases sperm number and motile activity in rats[1][2][3].

• HY-W743988

  Cilastatin ammonium salt	Inhibitor
  Cilastatin ammonium salt is an antibiotic that is relatively effective against Gram-positive cocci with a half-life of 3-4 h[1].

• HY-B1784R

  Sulfisomidin (Standard)	Inhibitor
  Sulfisomidin (Standard) is the analytical standard of Sulfisomidin. This product is intended for research and analytical applications. Sulfisomidin (Sulfaisodimidine) is an orally active short-acting sulfonamide antibacterial. Sulfisomidin can be used for the research of lower urinary tract infections[1][2].

• HY-19915

  Contezolid	Inhibitor	99.37%
  Contezolid (MRX-I), a new and orally active oxazolidinone, is an antibiotic in study for complicated skin and soft tissue infections (cSSTI) caused by resistant Gram-positive bacteria. Contezolid (MRX-I) markedly reduces potential for myelosuppression and monoamine oxidase inhibition (MAOI)[1][2].

• HY-14136

  Rimonabant	Inhibitor	99.18%
  Rimonabant (SR141716) is a highly potent, brain penetrated and selective central cannabinoid receptor (CB1) antagonist with a Ki of 1.8 nM. Rimonabant (SR141716) also inhibits Mycobacterial membrane protein Large 3 (MMPL3).

• HY-17390R

  Loxapine (Standard)	Inhibitor
  Loxapine (Standard) is the analytical standard of Loxapine. This product is intended for research and analytical applications. Loxapine is an orally active dopamine inhibitor, 5-HT receptor antagonist and also a dibenzoxazepine anti-psychotic agent[1][4].

• HY-14879S2

  Avibactam sodium salt-13C5	Inhibitor
  Avibactam sodium salt-13C5 (NXL-104-13C5) is 13C labeled Avibactam (sodium). Avibactam sodium (NXL-104) is a covalent and reversible non-β-lactam β-lactamase inhibitor which inhibits β-lactamase TEM-1 and CTX-M-15 with IC50s of 8 nM and 5 nM, respectively[1][2].

• HY-B1246R

  Thonzonium (bromide) (Standard)	Inhibitor
  Thonzonium (bromide) (Standard) is the analytical standard of Thonzonium (bromide). This product is intended for research and analytical applications. Thonzonium bromide is an antibacterial agent that is structurally similar to Farnesol (HY-Y0248A). Thonzonium bromide is also a monocationic surface-active agent, which inhibits RANKL-induced osteoclast formation and bone resorption in vitro and prevents LPS-induced bone loss in vivo. Thonzonium bromide inhibits proton transport in a dose-dependent manner (EC50=69 μM)[1][2][3].

• HY-P10211

  Virgilagicin	Inhibitor
  Virgilagicin is a Gram-positive active antibiotic that has a dual polyprenyl phosphate binding mechanism that impedes resistance development[1].

• HY-N8221

  Homoembelin	Inhibitor
  Homoembelin is an antimicrobial compound and has the potential for MDR bacterial infection research[1].

• HY-150589

  InhA-IN-4	Inhibitor
  InhA-IN-4 (TU14) is a Mycobacterium tuberculosis InhA (an enoyl ACP-reductase) inhibitor with an IC50 of 15.6 μM[1].

• HY-157315

  Fabl inhibitor 21272541	Inhibitor
  21272541 is a potent inhibitor of FabI protein. 21272541 significantly inhibits the infections caused by Gram-negative organisms[1].

• HY-155104

  MBL-IN-1	Inhibitor
  MBL-IN-1 (compound 41) is a β-Lactamase inhibitor, with the IC50 ranging from 0.10 to 25.85 µM. MBL-IN-1 can be used for research of bacterial infections[1].

• HY-A0248B

  Polymyxin B2	Inhibitor
  Polymyxin B2 is a polypeptide antibiotic that has antibacterial activity, particularly against gram-negative bacteria. Polymyxin B2 kills the bacteria by binding to lipopolysaccharide molecules on the bacterial cell membrane, disrupting the integrity of the cell membrane and causing the cell contents to leak. Polymyxin B2 can be used in antibiotic development and treatment of drug-resistant strains[1].

• HY-163353

  Antibacterial agent 193	Inhibitor
  Antibacterial agent 193 (Compound 2n) is A monobenzene derivative of spiromarone A, which has antibacterial activity against Rhizoctonia solani. with IC50 value of 5.25 μg/mL[1].

• HY-14865B

  Omadacycline tosylate	Inhibitor	99.37%
  Omadacycline (PTK 0796) tosylate, a first-in-class orally active aminomethylcycline antibacterial, is a member of the tetracycline class of antibiotics. Omadacycline tosylate acts through the inhibition of bacterial protein synthesis by binding to the 30S ribosomal subunit. Omadacycline tosylate possesses broad-spectrum antibacterial activity against aerobic and anaerobic Gram-positive and Gram-negative bacteria, as well as atypical bacteria. Omadacycline tosylate can be used for the research of acute bacterial skin and skin-structure infections, community-acquired pneumonia, and urinary tract infections[1][2][3][4].

• HY-A0166A

  Cilastatin sodium	Inhibitor	98.84%
  Cilastatin sodium (MK0791 sodium) is a reversible, competitive renal dehydropeptidase I inhibitor with an IC50 of 0.1 μM. Cilastatin sodium inhibits the bacterial metallob-lactamase enzyme CphA with an IC50 of 178 μM. Cilastatin sodium is an antibacterial adjunct[1][2][3].

• HY-Y1718S

  Tridecanoic acid-d2	Inhibitor	98.71%
  Tridecanoic acid-d2 is the deuterium labeled Tridecanoic acid. Tridecanoic acid (N-Tridecanoic acid), a 13-carbon medium-chain saturated fatty acid, can serve as an antipersister and antibiofilm agent that may be applied to research bacterial infections. Tridecanoic acid inhibits Escherichia coli persistence and biofilm formation[1].

• HY-17506A

  Azithromycin hydrate	Inhibitor
  Azithromycin hydrate is a macrolide antibiotic useful for the treatment of a number of bacterial infections.

• HY-W844796

  2-Amino-5-methyl-5-hexenoic acid	Inhibitor
  2-Amino-5-methyl-5-hexenoic acid ((S)-2-Amino-5-methylhex-5-enoic acid) is a Methionine analog that competes with methionine and resulting in inhibition of cell growth. 2-Amino-5-methyl-5-hexenoic acid inhibits protein synthesis but not DNA or RNA synthesis in S. typhimurium TA1535 and E. coli K-12[1]. X

• HY-14814R

  Delafloxacin (Standard)	Inhibitor
  Delafloxacin (Standard) is the analytical standard of Delafloxacin. This product is intended for research and analytical applications. Delafloxacin (RX-3341; WQ-3034; ABT492) is a broad-spectrum fluoroquinolone antibiotic. Delafloxacin has a broad spectrum of activity that includes drug-resistant Staphylococcus aureus, Streptococcus pneumoniae, and Klebsiella pneumonia[1].

• HY-B0525AR

  Carbenicillin (disodium) (Standard)	Inhibitor
  Carbenicillin (disodium) (Standard) is the analytical standard of Carbenicillin (disodium). This product is intended for research and analytical applications. Carbenicillin disodium (Sodium carbenicillin) is a broad-spectrum semi-synthetic penicillin antibiotic for gram-negative bacteria. Carbenicillin disodium can interfere the cell wall synthesis while displaying low toxicity to plant tissue[1].

• HY-I0447

  4-Aminosalicylic acid	Inhibitor
  4-Aminosalicylic acid (ASA) is an orally active antibiotic and has the potential to treat tuberculosis[1].

• HY-120568

  M4284	Inhibitor	98.15%
  M4284 is a selective and orally active biphenyl mannoside FimH antagonist. M4284 has activities against different UPEC (Urinary tract infections (UTI) caused by uropathogenic E. coli) strains in different host genetic backgrounds and gut microbial community contexts[1].

• HY-W068682

  1-Hydroxyphenazine	Inhibitor	99.80%
  1-Hydroxyphenazine (Hemipyocyanine; 1-Phenazinol; Hemi-pyocyanin) is an inhibitor for α-Amylase with an IC50 of 3.1 μg/mL[1]. 1-Hydroxyphenazine exhibits anticancer and anti-inflammatory activity against cells A549, 1321N1 and RAW264.7, antifungal and antibacterial activity against strains Candida albicans, Aspergillus fumigatus, Escherichia coli and Xanthomonas campestris[2][3][4][5].

• HY-B0934

  Ethylparaben	Inhibitor
  Ethylparaben is the ethyl ester of paraben and is used as an antifungal preservative and food additive[1][2].

• HY-N7610

  Acetylalkannin	Inhibitor	99.85%
  Acetylalkannin (Alkannin acetate) is an isohexenylnaphthazarin pigment isolated from Arnebia euchroma with antimicrobial and cytotoxic activities[1].

• HY-147787

  Urease-IN-3
  Urease-IN-3 (Compound L12) is a potent inhibitor of Urease with an IC50 of 1.449 μM. Urease-IN-3 is a flavonoid analogue compound[1].

• HY-P5580

  Dermaseptin-B3	Inhibitor
  Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (MIC: 1.3, 2.3, 5.0, 2.6, 2.3 μM for S. aureus, P. aeruginosa, P. aeruginosa, E. (ATCC 25922), E. (54127) respectively). Dermaseptin-B3 also inhibits tumor cell proliferation[1][2].

• HY-B1071AR

  Lasalocid (sodium) (Standard)	Inhibitor
  Lasalocid (sodium) (Standard) is the analytical standard of Lasalocid (sodium). This product is intended for research and analytical applications. Lasalocid sodium (Lasalocid-A sodium) is an antibacterial agent.

• HY-144737

  Anti-inflammatory agent 15	Inhibitor
  Anti-inflammatory agent 15 (compound 29) is a potent antimycobacterial and anti-inflammatory agent. Anti-inflammatory agent 15 inhibits Mtb H37Rv and M299 growth, with MIC50 (minimum inhibitory concentration 50%) of 2.3 and 7.8 μM, respectively. Anti-inflammatory agent 15 inhibits NO through the suppression of iNOS expression, and also inhibited the production of TNF-α and IL-1β. Anti-inflammatory agent 15 can be used for tuberculosis (TB) research[1].

• HY-N7141R

  Spiramycin I (Standard)
  Spiramycin I (Standard) is the analytical standard of Spiramycin I. This product is intended for research and analytical applications. Spiramycin I is a macrolide antibiotic and antiparasitic[1].

• HY-148286R

  Gentamicin C1a (Standard)	Inhibitor
  Gentamicin C1a (Standard) is the analytical standard of Gentamicin C1a. This product is intended for research and analytical applications. Gentamicin C1a is the precursor of the semi-synthetic antibiotic Etimicin, and has antibacterial activity. Gentamicin C1a is the major component of the Gentamicin complex[1][2].

• HY-P1063A

  LF11 TFA	Inhibitor
  LF11 TFA is a peptide with antibacterial activity[1].

• HY-169065

  Antibacterial agent 241	Inhibitor
  Antibacterial agent 241 is a histidine kinase (HK) inhibitor, with IC50 values of 14 μM and 238 μM for CckA and PhoQ, respectively. Antibacterial agent 241 shows moderate antibacterial activity against E. coli DC2, Bacillus cereus, and Bacillus subtilis, with a MIC range of 12-74 μg/mL[1].

• HY-B0565S

  Ronidazole-d3	Inhibitor
  Ronidazole-d3 is the deuterium labeled Ronidazole (HY-B0565)[1]. Ronidazole is a potent and orally active antiprotozoal and anti-microbial agent. Ronidazole acts as a veterinary agent against Tritrichomonas foetus?in cats models. Ronidazole can be used the research of forhistomoniasis?and?swine?dysentery[2].

• HY-P4751

  LL-37 RKS	Inhibitor
  LL-37 RKS is an active fragment of LL-37[1].

• HY-W272217S

  Octacosane-d58		99.05%
  Octacosane-d58 is the deuterium labeled Octacosane[1]. Octacosane is an endogenous metabolite with antibacterial activity. Octacosane shows high cytotoxicity against murine melanoma B16F10-Nex2 cells besides inducing protection against a grafted subcutaneous melanoma. Octacosane has the larvicidal activity against mosquito Culex quinquefasciatus with the LC50 concentration of 7.2 mg/l[2][3][4].

• HY-14136S

  Rimonabant-d10	Inhibitor
  Rimonabant-d10 is deuterium labeled Rimonabant. Rimonabant (SR141716) is a highly potent, brain penetrated and selective central cannabinoid receptor (CB1) antagonist with a Ki of 1.8 nM. Rimonabant (SR141716) also inhibits Mycobacterial membrane protein Large 3 (MMPL3).

• HY-P5698

  Cyclopetide 1	Inhibitor
  Cyclopetide 1 (Compound 1) is an antimicrobial peptide with moderate activity against B. subtilis, with a MIC of 25 μg/mL[1].

• HY-B1463R

  Penicillin G sodium salt (Standard)	Inhibitor
  Penicillin G sodium salt (Standard) is the analytical standard of Penicillin G sodium salt. This product is intended for research and analytical applications. Penicillin G sodium salt is a typical β-lactam antibiotic.

• HY-W653962

  Triclosan-13C6	Inhibitor
  Triclosan-13C6 is 13C labeled Triclosan. Triclosan is a broad-spectrum antibacterial agent that inhibits bacterial fatty acid synthesis at the enoyl-acyl carrier protein reductase (FabI) step. Triclosan inhibits E. coli enoyl-acyl carrier protein reductase (FabI) and FabI containing a glycine-to-valine substitution at position 93 (FabIG93V) with IC50s of 2 μM and 10 μM, respectively. Triclosan causes apoptotic effect in cultured rat neural stem cells (NSC). Triclosan exacerbates colitis and colitis-associated colorectal tumorigenesis in animal models[1][2][3][4].

• HY-137945R

  Phenethicillin (sodium) (Standard)	Inhibitor
  Phenethicillin (sodium) (Standard) is the analytical standard of Phenethicillin (sodium). This product is intended for research and analytical applications. Phenethicillin (α-Phenoxyethylpenicillin) sodium is a Penicillin, and has antimicrobial activity[1].

• HY-14800R

  Radezolid (Standard)	Inhibitor

• HY-W015461

  2-Aminooctanoic acid	Inhibitor
  2-Aminooctanoic acid (DL-α-Aminocaprylic acid) is a fatty acid with an amino functional group that can be directly coupled at both the C-terminal and N-terminal with antimicrobial peptides (AMP) derived from lactoferrin B to enhance antibacterial activity[1].

• HY-148493

  MK-3402	Inhibitor	99.96%
  MK-3402 (Compound303) is a metallo-beta-lactamase inhibitor, with IC50 values of 0.53, 0.25 and 0.169 nM against IMP-1, NDM-1, and VIM-1, respectively. MK-3402 can be used in bacterial research and shows a synergistic effect when used in combination with beta-lactam antibiotics[1].

• HY-B1354

  Cefpiramide	Inhibitor
  Cefpiramide (SM-1652) free acid is a semisynthetic cephalosporin with broad-spectrum antibacterial activity. Cefpiramide free acid shows strong antibacterial effect on both gram-positive bacteria and gram-negative bacteria. Cefpiramide free acid is moderately susceptible to β-lactamase[1][2].

• HY-B1119

  Triclosan	Inhibitor
  Triclosan is a broad-spectrum antibacterial agent that inhibits bacterial fatty acid synthesis at the enoyl-acyl carrier protein reductase (FabI) step. Triclosan inhibits E. coli enoyl-acyl carrier protein reductase (FabI) and FabI containing a glycine-to-valine substitution at position 93 (FabIG93V) with IC50s of 2 µM and 10 µM, respectively. Triclosan causes apoptotic effect in cultured rat neural stem cells (NSC). Triclosan exacerbates colitis and colitis-associated colorectal tumorigenesis in animal models[1][2][3].

• HY-147505

  Antitubercular agent-21	Inhibitor
  Antitubercular agent-21 (Compound 15) is an antitubercular agent with an MIC of o.4 µg/mL against M. tuberculosis H37Rv. Antitubercular agent-21 exhibits lower activity against other microorganism such as bacteria gram-positive, gram-negative or fungi. Antitubercular agent-21 shows low cytotoxicity[1].

• HY-N0216S2

  Benzoic acid-13C	Inhibitor
  Benzoic acid-13C is the 13C-labeled Benzoic acid. Benzoic acid is an aromatic alcohol existing naturally in many plants and is a common additive to food, drinks, cosmetics and other products. It acts as preservatives through inhibiting both bacteria and fungi.

• HY-106339

  Lymecycline	Inhibitor
  Lymecycline is a tetracycline derivative, with broad-spectrum antibacterial activity and also has anti-inflammatory property.

• HY-12638R

  Dichlorophen (Standard)	Inhibitor
  Dichlorophen (Standard) is the analytical standard of Dichlorophen. This product is intended for research and analytical applications. Dichlorophen (DDM) is an anticestodal agent. Dichlorophen is an antimicrobial agent shown to exert activity against cestodes, protozoa, fungi, and bacteria.

• HY-N0349S

  Methyl paraben-d4
  Methyl paraben-d4 is the deuterium labeled Methyl Paraben[1]. Methyl Paraben, isolated from the barks of Tsuga dumosa the methyl ester of p-hydroxybenzoic acid, is a standardized chemical allergen. Methyl Paraben is a stable, non-volatile compound used as an antimicrobial preservative in foods, agents and cosmetics. The physiologic effect of Methyl Paraben is by means of increased histamine release, and cell-mediated immunity[2].

• HY-B1207R

  Urethane (Standard)	Inhibitor
  Urethane (Standard) is the analytical standard of Urethane. This product is intended for research and analytical applications. Urethane (Ethyl carbamate), the ethyl ester of carbamic acid, is a byproduct of fermentation found in various food products. Urethane has the ability to suppress bacterial, protozoal, sea urchin egg, and plant tissue growth in vitro[1].

• HY-W267444

  Pentyl 4-hydroxybenzoate	Inhibitor
  Pentyl 4-hydroxybenzoate (Amylparaben) is a type of paraben compound commonly used as a preservative, it has antibacterial properties and is related to the inhibition of induced oxygen consumption[1].

• HY-N6612B

  Glucuronic acid sodium	Inhibitor
  Glucuronic acid sodium is a polysaccharide that exhibits anti-inflammatory activity, supporting the healing of ulcerative colitis. Glucuronic acid sodium also enhances the intestinal barrier by upregulating tight junction proteins like ZO-1 and Occludin. Furthermore, Glucuronic acid sodium plays a role in modulating gut microbiota by increasing beneficial bacterial populations while suppressing harmful ones.

• HY-119405

  Niddamycin	Inhibitor
  Niddamycin, a macrolide antibiotic, binds 50S ribosomal subunits to inhibit protein synthesis[1].

• HY-P5686

  Maximin 78	Inhibitor
  Maximin 78 is an antimicrobial peptide. Maximin 78 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 37.5, 4.7, 37.5 μg/mL). Maximin 78 has hemolytic activities against human and rabbit red cells[1].

• HY-N1203

  (5α)-Stigmastane-3,6-dione	Inhibitor
  (5α)-Stigmastane-3,6-dione is a naturally occurring sterol that could be isolated from fruits of Ailanthus altissima Swingle. Antimicrobial Activity.[1].

• HY-117742

  DA-7867	Inhibitor
  DA-7867 is an antibacterial compound with activity against a wide range of bacteria, including drug-resistant bacteria. DA-7867 shows promising antibacterial activity against some clinically important pathogens, including drug-resistant bacteria. It is an amide analog of Tedizolid, reflecting the potential use of tetrazoles in the development of new antibacterial agents.

• HY-N3798

  Effusanin A	Inhibitor
  Effusanin A is a natural product that can be found in Isodon rugosus. Effusanin A exhibits DNA-damaging and antibacterial activities[1].

• HY-111405

  Antimicrobial Compound 1	Inhibitor
  Antimicrobial Compound 1 is an alkylpyridinium compound, with antimicrobial activity.

• HY-B1825

  Cefoxitin	Inhibitor	99.84%
  Cefoxitin, a β-lactam antibiotic, is a broad-spectrum, second-generation cephalosporin. Cefoxitin has a broad spectrum antibacterial activity which includes anaerobic as well as Gram-positive and Gram-negative aerobic bacteria[1][2].

• HY-147959

  Antibacterial agent 114	Inhibitor
  Antibacterial agent 114 (compound 1) is a potent antibacterial agent. Antibacterial agent 114 shows antibacterial activity against P.aeruginosa, B.subtilis, E.coli, E.faecalis, S.typhimuriumand, S.mutans, and S.aureus microorganisms, with MIC values of 625, 625, 625, 625, 625, 1250 and 1250 μM, respectively[1].

• HY-B0289

  Erdosteine	Inhibitor	99.62%
  Erdosteine inhibits lipopolysaccharide (LPS)-induced NF-κB activation[1][2]. Erdosteine has muco-modulatory, anti-bacterial, anti-inflammatory and anti-oxidant effects[3].

• HY-W587486

  N-Acetyltaurine	Activator
  N-Acetyltaurine is a sulfonate that can serve as a carbon source or a nitrogen source, and an energy source for microbial growth (such as the NAT strain). Additionally, N-Acetyltaurine is also a substrate for the amidase enzyme, porcine kidney N-acetyl-β-alanine deacetylase [EC 3.5.1.21][1].

• HY-149095

  Antibacterial agent 139	Inhibitor
  Antibacterial agent 139 has antibacterial activity against Gram-positive bacteria. Antibacterial agent 139 has anti-MRSA, anti-VISA, and anti-LRSE activities. Antibacterial agent 139 depolarizes the bacterial cell membrane[1].

• HY-126460

  Myristoyl glutamic acid	Inhibitor
  Myristoyl glutamic acid is a myristoyl glutamic acid. Myristoyl glutamic acid is an amino acid surfactant, which can be used as cleansers, foaming agents in the cosmetic industry. Myristoyl glutamic acid shows a slight antibacterial effect[1].

• HY-17028R

  Besifloxacin (Hydrochloride) (Standard)	Inhibitor
  Besifloxacin (Hydrochloride) (Standard) is the analytical standard of Besifloxacin (Hydrochloride). This product is intended for research and analytical applications. 0

• HY-116541

  Acibenzolar-S-methyl	Inhibitor
  Acibenzolar-S-methyl (ASM) is a plant resistance inducer that mimics pathogen-host interactions and leads to systemic acquired resistance in plants. Acibenzolar-S-methyl helps reduce the use of pesticides and can be used in research to prevent plant diseases[1][2].

• HY-B0567

  Dequalinium Chloride	Inhibitor	99.91%
  Dequalinium chloride is an Apamin (HY-P0256)-sensitive potassium channel selective blocker. Dequalinium chloride is a cationic, lipophilic mitochondrial poison. Dequalinium chloride is also an antagonist pf α7 nAChR, and an anti-microbial antiseptic agent with a broad bactericidal and fungicidal activity[1][2][3][4].

• HY-139597R

  Temocillin (disodium) (Standard)	Inhibitor
  Temocillin (disodium) (Standard) is the analytical standard of Temocillin (disodium). This product is intended for research and analytical applications. Temocillin disodium, a 6-α-methoxy penicillin, possesses antibacterial activity[1].

• HY-155067

  Antitubercular agent-38	Inhibitor
  Antitubercular agent-38 is an orally active Benzothiazinones (BTZs) derivate, with potent antituberculosis activity. Antitubercular agent-38 exhibits low cardiac toxicity, low cell cytotoxicity[1].

• HY-N9477

  Betulinic aldehyde oxime	Inhibitor
  Betulinic aldehyde oxime (Compound 31) is a betulin (HY-N0083) derivative that has antimicrobial properties against E. aerogenes, E. coli, E. faecalis, P. aeruginosa, S. aureus, and C. albicans. Betulinic aldehyde oxime displays cytotoxicity towards hepatocytes, with an IC50 of 25 μM[1].

• HY-W587753

  Bacitracin A	Inhibitor
  Bacitracin A is an antibiotic, which exhibits antibacterial activity against gram-positive bacteria. Bacitracin A forms complex with long-chain polyisoprenyl pyrophosphates in presence of metal ions, dephosphorylates the lipid carrier intermediate Css-bactoprenyl pyrophosphate, inhibits thus the bacterial cell wall biosynthesis[1].

• HY-160648

  InhA-IN-6	Inhibitor
  InhA-IN-6 (compound 8) is InhA inhibitor with the IC50 of 90 nM[1].

• HY-N2612

  O-Methyldauricine	Inhibitor
  O-Methyldauricine ((-)-O-Methyldauricine) is an alkaloid with benzylisoquinoline group, which can be separated from P. ophthalmicus. O-Methyldauricine has antibacterial activity[1][2].

• HY-B0454A

  Miconazole nitrate	Inhibitor	99.97%
  Miconazole nitrate (R18134 nitrate) is an imidazole antifungal agent. Miconazole nitrate also has antibacterial effects[2].

• HY-131102

  Mequindox	Inhibitor	99.67%
  Mequindox is an antimicrobial agent[1]. Mequindox acts as an inhibitor of DNA synthesis. Mequindox induces genotoxicity and carcinogenicity in mice[2].

• HY-106925

  Cetefloxacin	Inhibitor
  Cetefloxacin (E 4868) is a board-spectrum antibacterial antibiotic, MIC of 0.007-8 µg/ml. Cetefloxacin exhibits good pharmacokinetic characters in mice. Cetefloxacin exhibits protective effects against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, and Streptococcus pneumoniae in mice[1].

• HY-P5203

  Enterocin K1	Inhibitor
  Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections[1].

• HY-119123

  Voxvoganan	Inhibitor
  Voxvoganan (LTX-109), a topical antimicrobial, is highly effective against S. aureus with a MIC range of 2 to 4 μg/mL. Voxvoganan can be used for the research of bacterial skin infections, fungal infections and nasal decolonisation of MRSA[1][2].

• HY-P3444

  CD31		99.33%
  CD31 (PECAM-1) is platelet endothelial cell adhesion molecule-1, serves as the endothelial cell-specific receptor of clostridium perfringens b-Toxin (CPB). CD31 is also an ER-MP12 antigen, acts as a linker between mechanical stress, metabolism and inflammation. CD31 peptide is able to sustain phosphorylation of the CD31 ITIM686 and of SHP2 and to inhibit TCR-induced T-cell activation[1]-[5].

• HY-48958

  Protein kinase G inhibitor-1	Inhibitor
  Protein kinase G inhibitor-1 (Compound 270) is a mycobacterial protein kinase G inhibitor, with an IC50 of 0.9 μM. Protein kinase G inhibitor-1 can be used for mycobacterial infection research[1].

• HY-P3078

  Amphomycin	Inhibitor
  Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin exhibits potent antibacterial activities against methicillin-resistant S. aureus (MRSA), vancomycin-resistant enterococci (VRE), penicillin-gentamicin-erythromycin-resistant S. pneumonia, and linezolid-quinupristin-dalfopristin-resistant enterococci[1][2][3].

• HY-107798R

  Potassium guaiacolsulfonate (hemihydrate) (Standard)	Inhibitor
  Potassium guaiacolsulfonate (hemihydrate) (Standard) is the analytical standard of Potassium guaiacolsulfonate (hemihydrate). This product is intended for research and analytical applications. Potassium guaiacolsulfonate hemihydrate is an orally active expectorant used for acute respiratory tract infections. Potassium guaiacolsulfonate hemihydrate helps loosen mucus and used for a cough caused by the common cold, infections or allergies in combination with other agents[1][2].

• HY-17035

  Doramectin		98.83%
  Doramectin is a derivative of Ivermectin (HY-15310). Doramectin is a potent antiparasitic antibiotic. Doramectin is an active compound against S.mansoni in an NMRI mouse infection model[1][2][3].

• HY-114147

  Tuberculosis inhibitor 3	Inhibitor	98.50%
  Tuberculosis inhibitor 3 (compound 2i) displays potent anti-TB activity (MIC < 0.016 μg/mL) against agent-sensitive/resistant MTB strains. Tuberculosis inhibitor 3 (compound 2i) shows acceptable PK profiles with oral bioavailability[1].

• HY-118547

  Clorofene	Inhibitor
  Clorofene (2-Benzyl-4-chlorophenol) is an aryl halide fungicide widely used in hospitals and homes as a broad-spectrum fungicide in general cleaning and disinfection disinfectant solutions and in soap formulations. Clorofene has antibacterial and carcinogenic activity[1][2].

• HY-108988

  Albicidin	Inhibitor
  Albicidin is a peptide antibiotic with activity against various Gram-positive and Gram-negative microorganisms[1].

• HY-W779009

  [1-13Cglc]Lactose monohydrate	Inhibitor
  [1-13Cglc]Lactose monohydrate is an isotopic labeling drug[1].

• HY-B1275AR

  Cephalothin (Standard)	Inhibitor
  Cephalothin (Standard) is the analytical standard of Cephalothin. This product is intended for research and analytical applications. Cephalotin (Cephalotin) is a beta-lactam antibiotic, inhibits class C β-lactamase AmpC, with an Ki of 0.32 µM[1].

• HY-116863R

  KKL-40 (Standard)	Inhibitor
  Fructose (Standard) is the analytical standard of Fructose. This product is intended for research and analytical applications. Fructose is a simple ketonic monosaccharide found in many plants, where it is often bonded to glucose to form the disaccharide sucrose.

• HY-130187

  Sapienic acid	Inhibitor
  Sapienic acid is a fatty acid commonly found on the skin and in mucosa. Sapienic acid has variable antimicrobial activities against Gram-positive and Gram-negative bacteria found on the skin and in the oral cavity. Sapienic acid is active against Streptococcus sanguinis, Streptococcus mitis and Fusobacterium nucleatum with MBC values of 31.3 μg/mL, 375.0 μg/mL and 93.8 μg/mL, respectively[1].

• HY-142545

  Antibacterial agent 68
  Antibacterial agent 68 (compound 4d) is an antibacterial agent against drug-resistant Escherichia coli. Antibacterial agent 68 has low cytotoxicity and exerts strong antibacterial activities against multidrug-resistant Escherichia coli at low concentrations as 0.007 mM[1].

• HY-B1381A

  Cefixime trihydrate	Inhibitor	99.77%
  Cefixime trihydrate (FR-17027 trihydrate) is an antibiotic and a third generation cephalosporin antibiotic, useful for the treatment of a number of bacterial infections[1][2].

• HY-B0035B

  Sulfamethazine 100 µg/mL in acetonitrile	Inhibitor
  Sulfamethazine 100 μg/mL in acetonitrile (Sulfadimidine 100 μg/mL in acetonitrile) is an antimicrobial agent that induces CYP3A4 expression and is acetylated by N-acetyltransferase. It exhibits sex-dependent pharmacokinetics and is metabolized by CYP2C11 in males.

• HY-W157376

  PAMAM Dendrimer G0.0 amine	Inhibitor
  PAMAM Dendrimer G0.0 amine is a pore-forming channel antagonist, including anthrax toxin protective antigen 63 (PA63, IC50 = 231 nM) and C. botulinum C2 toxin subunit (C2IIa, IC50 = 940 nM). At concentrations of 10 and 20 µM, PAMAM Dendrimer G0.0 amine reduces C2 toxin-induced death in HeLa cells. Additionally, PAMAM Dendrimer G0.0 amine is a chelator of nickel. In complexes with polysulfone membrane-bound chitosan, PAMAM Dendrimer G0.0 amine selectively captures and stores carbon dioxide (CO2) in a gas-feed system. PAMAM Dendrimer G0.0 amine has been used in the synthesis of PAMAM Dendrimer G0.5 Carboxylate (CAS 339334-01-9) and PAMAM Dendrimer G1.0 Amine (CAS 142986-44-5). PAMAM Dendrimer G0.0 amine can be used in research related to infections, cancer, and drug delivery systems[1][2][3][4].

• HY-B1217

  Bronopol	Inhibitor
  Bronopol is an antibacterial agent with low toxicity (to mammals) and high activity (especially against Gram-negative bacteria).

• HY-B0275S

  Oxytetracycline-d6	Inhibitor
  Oxytetracycline-d6 is deuterium labeled Oxytetracycline. Oxytetracycline is an antibiotic belonging to the tetracycline class. Oxytetracycline potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline also possesses anti-HSV-1 activity[1][2][3][4].

• HY-124084

  SW203668	Inhibitor
  SW203668 is a benzothiazole compound, shows anti-tumor activity against lung cancer cell lines (IC50=0.022-0.116 μM)

• HY-W009156R

  Citric acid (tripotassium hydrate) (Standard)	Inhibitor
  Citric acid (tripotassium hydrate) (Standard) is the analytical standard of Citric acid (tripotassium hydrate). This product is intended for research and analytical applications. Hydroxycitric acid tripotassium hydrate (Potassium citrate monohydrate) is the major active ingredient of Garcinia cambogia. Hydroxycitric acid tripotassium hydrate competitively inhibits ATP citrate lyase with weight loss benefits. Hydroxycitric acid tripotassium hydrate effective inhibits stones formation and also inhibits HIF, and has antioxidation, anti-inflammation and anti-tumor effects[1][2][3][4].

• HY-107164

  Thiomarinol A	Inhibitor
  Thiomarinol A (4-Hydroxythiomarinol C) is a potent antibiotic. Thiomarinol A is a hybrid of dithiolopyrrolone and marinolic acid. Thiomarinol A shows antimicrobial activity. Thiomarinol A inhibits MRSA IleRS in a dose-dependent with a Kiapp value of 19 nM[1].

• HY-139758

  Antibacterial agent 41	Inhibitor
  Antibacterial agent 41 (example 3) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-113952

  Actinonin	Inhibitor
  Actinonin ((-)-Actinonin) is a naturally occurring antibacterial agent produced by Actinomyces. Actinonin inhibits aminopeptidase M, aminopeptidase N and leucine aminopeptidase. Actinonin is a potent reversible peptide deformylase (PDF) inhibitor with a Ki of 0.28 nM. Actinonin also inhibits MMP-1, MMP-3, MMP-8, MMP-9, and hmeprin α with Ki values of 300 nM, 1,700 nM, 190 nM, 330 nM, and 20 nM, respectively. Actinonin is an apoptosis inducer. Actinonin has antiproliferative and antitumor activities[1][2][3][4][5].

• HY-P5618

  Maximin H2	Inhibitor
  Maximin H2 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H2 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 20, 2, 4, 2 μg/ml, respectively[1].

• HY-146451

  PXYC12	Inhibitor
  PXYC12 is a ribosomal protein S1 (RpsA) antagonist with Kds of 2.67 and 4.67 μM for RpsA-CTD and RpsA-CTD Δ438A, respectively. RpsA plays an important role in the trans-translation process of Mycobacterium Tuberculosis (Mtb)[1].

• HY-B0398AR

  Nalidixic acid (sodium salt) (Standard)	Inhibitor
  Liquiritin (Standard) is the analytical standard of Liquiritin. This product is intended for research and analytical applications. Liquiritin, a flavonoid isolated from Glycyrrhiza uralensis, is a potent and competitive AKR1C1 inhibitor with IC50s of 0.62 μM, 0.61 μM, and 3.72μM for AKR1C1, AKR1C2 and AKR1C3, respectively. Liquiritin efficiently inhibits progesterone metabolism mediated by AKR1C1 in vivo[1]. Liquiritin acts as an antioxidant and has neuroprotective, anti-cancer and anti-inflammatory activity[2].

• HY-N8395

  Tunicamycin V	Inhibitor
  Tunicamycin V (Tunicamycin A) is a nucleoside natural product that inhibits bacterial phospho-N-acetylmuramyl-pentapeptide transferase (MraY) with an IC50 of 0.35?μM. Tunicamycin V has antibacterial activties[1][2].

• HY-B0510R

  Trimethoprim (Standard)	Inhibitor
  Trimethoprim (Standard) is the analytical standard of Trimethoprim. This product is intended for research and analytical applications. Trimethoprim is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim has the potential for the research of urinary tract infections, Shigellosis and Pneumocystis pneumonia. Trimethoprim can inhibit infection of Influenza A virus in chick embryo when combinated with zinc[1][2][3][4].

• HY-N10516

  Bacteriopheophytin	Inhibitor
  Bacteriopheophytin, a photosynthetic pigment, is a bacterial demagnetised chlorophyll composed of bacterial chlorophyll in which two hydrogen atoms replace the magnesium center. Bacteriopheophytin acts as an electron acceptor in the purple bacterial reaction center (RC) and is involved in electron transfer[1].

• HY-118512

  Platencin	Inhibitor
  Platencin is a natural, broad spectrum Gram-positive antibiotic isolated from S. platensis. Platencin inhibits β-ketoacyl-ACP synthases II and III (FabF and FabH, respectively) with IC50s of 1.95 and 3.91 μg/ml, respectively[1].

• HY-44178

  Diethyl butylmalonate	Inhibitor	99.79%
  Diethyl butylmalonate exhibits toxicity to T. pyriformis, with a log(IGC50-1) of 0.557[1].

• HY-A0277

  Cyproconazole	Inhibitor	98.72%
  Cyproconazole is a triazole fungicide that is used agriculturally for protection of crops against a wide variety of fungal pathogens.

• HY-N3056R

  Pinosylvin monomethyl ether (Standard)
  Pinosylvin monomethyl ether (Standard) is the analytical standard of Pinosylvin monomethyl ether. This product is intended for research and analytical applications. Pinosylvin monomethyl ether has antibacterial effect[1] and fungicidal activity[2].

• HY-N8935

  Eucamalduside A
  Eucamalduside A can be isolated from the leaves of Eucalyptus camaldulensis. Eucalyptus camaldulensis has antibacterial and antifungal activity[1][2][3].

• HY-P5660

  Brevinin-2
  Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta[1].

• HY-B0712S

  Ceftriaxone-d3 disodium	Inhibitor
  Ceftriaxone-d3 (disodium) is the deuterium labeled Ceftriaxone. Ceftriaxone is a third-generation cephalosporin antibiotic with excellent activity against many gram-negative, and reasonable activity against most gram-positive microorganisms. Anti-inflammatory and antioxidant characteristics[1][2].

• HY-A0155

  Viomycin
  Viomycin is a potent antibiotic against Mycobacteria. Viomycin rapidly inhibits polypeptide chain elongation when added to purified endogenous Escherichia coli polysomes actively engaged in polypeptide synthesis[1][2].

• HY-125789

  PF-04753299	Inhibitor	99.58%
  PF-04753299 is a potent and selective UDP-3-O-(R-3-hydroxymyristol)-N-acetylglucosamine deacetylase (LpxC) inhibitor. PF-04753299 is bactericidal for the gonococcal isolates. PF-04753299 inhibits E. coli, P. aeruginosa and K. pneumoniae strains with MIC90 values of 2 μg/ml, 4 μg/ml and 16 μg/ml, respectively. PF-04753299 is used for the study of gram-negative bacteria infection[1].

• HY-N13871

  Anguibactin	Inhibitor
  Anguibactin is an antibiotic that acts as a siderophore. Anguibactin has a strong affinity with Fe3+[1].

• HY-125097

  5'-Hydroxy-staurosporine
  5'-Hydroxy-staurosporine is an indolocarbazole alkaloid that can be isolated from marine Micromonospora sp. (strain L-31-CLCO-002). 5'-Hydroxy-staurosporine can be used in tumor related research[1].

• HY-N1870

  1β-Hydroxy-4(15),5E,10(14)-germacratriene
  1β-Hydroxy-4(15),5E,10(14)-germacratriene (compound 17) is a sesquiterpenoids that can be isolated from Chrysanthemum indicum.1β-Hydroxy-4(15),5E,10(14)-germacratriene significantly reduces PEDV nucleocapsid and spike protein synthesis.1β-Hydroxy-4(15),5E,10(14)-germacratriene shows various biological properties, such as antibacterial, antioxidant, and anti-inflammatory[1].

• HY-120011

  Ro 24-6392	Inhibitor
  Ro 24-6392 is an ester-linked co-drug combining Ciprofloxacin (HY-B0356) and Desacetylcefotaxime (HY-126129) with inhibitory activity against a variety of aerobic bacteria in vitro.

• HY-P5574

  Aurein 3.1	Inhibitor
  Aurein 3.1 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 80, 50, 50, 50, 50 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis)[1][2].

• HY-114544A

  N-3-oxo-dodecanoyl-L-homoserine lactone	Modulator
  N-3-oxo-dodecanoyl-L-Homoserine lactone (3-oxo-C12-HSL) is a bacterial quorum-sensing signaling molecule produced by P. aeruginosa and strains of the B. cepacia complex[1][2].Quorum sensing is a regulatory system used by bacteria for controlling gene expression in response to increasing cell density.N-3-oxo-dodecanoyl-L-Homoserine lactone induces the production of IL-8 in 16HBE human bronchial epithelial cells[3].

• HY-N11071

  Monascorubramine		98.09%
  Monascorubramine is a microbial colorant. Monascorubramine is capable of producing by the Monascus, which is from the bacteria Talaromyces. Under the condition of different pH value, the hue and chromaticity value of the colorant are also different[1].

• HY-12687S

  Tizoxanide-d4	Inhibitor	99.79%
  Tizoxanide-d4 is the deuterium labeled Tizoxanide. Tizoxanide is the active metabolite of Nitazoxanide, which is a thiazolide anti-infective compound against anaerobic bacteria, protozoa, and a range of viruses. Tizoxanide has anti-HIV-1 activities[1][2].

• HY-17586

  Dalbavancin hydrochloride	Inhibitor
  Dalbavancin hydrochloride (MDL-63397 hydrochloride) is a semisynthetic lipoglycopeptide antibiotic with potent bactericidal activity against Gram-positive bacteria. Dalbavancin hydrochloride inhibits Staphylococcus aureus and Bacillus anthracis with MIC90s of 0.06 μg/mL and 0.25 μg/mL, respectively[1][2].

• HY-B1418

  Tazobactam	Inhibitor
  Tazobactam (CL-298741) is a potent β-lactamases inhibitor and penicillin antibiotic. Tazobactam has antibacterial activity. Tazobactam can be used for pneumonia research[1][2].

• HY-N3947

  Glepidotin B
  Glepidotin B is a dihydroflavonol compound isolated from the extracts of American licorice, Glycyrrhiza lepidota (Leguminosae). Glepidotin B is an antimicrobial agent[1].

• HY-B0101S1

  Fluconazole-13C2,15N
  Fluconazole-13C2,15N (UK-49858-13C2,15N) is the 13C and 15N labeled isotope of Fluconazole (HY-B0101). Fluconazole (UK-49858) is a triazole antifungal agent with excellent activities against a broad range of fungi, especially against Candida albicans. Fluconazole inhibits C. albicans and Candida kefyr with IC99s range from 0.20 μg/mL to 0.39 μg/mL[1].

• HY-B1381AR

  Cefixime (trihydrate) (Standard)	Inhibitor
  Cefixime (trihydrate) (Standard) is the analytical standard of Cefixime (trihydrate). This product is intended for research and analytical applications. Cefixime trihydrate (FR-17027 trihydrate) is an antibiotic and a third generation cephalosporin antibiotic, useful for the treatment of a number of bacterial infections[1][2].

• HY-P5677

  Bombinin H5	Inhibitor
  Bombinin H5 is an antimicrobial peptide derived from the skin of moth Bombina variegata[1].

• HY-10392R

  Sutezolid (Standard)	Inhibitor

• HY-B0905S

  Tilmicosin-d3	Inhibitor
  Tilmicosin-d3 is the deuterium labeled Tilmicosin. Tilmicosin (LY-177370) is an orally active calcium channel antagonist and macrolide antibiotic with antimicrobial activity. Tilmicosin mainly acts on the 50S subunit of bacterial ribosomes, inhibiting protein synthesis. Tilmicosin is effective in the treatment of respiratory diseases in livestock such as cattle, sheep and pigs. In addition, Tilmicosin has immunomodulatory and anti-inflammatory effects[1][2].

• HY-B0898S

  Ceftiofur-d3 sodium	Inhibitor
  Ceftiofur-d3 (sodium) is deuterium labeled Ceftiofur (sodium).

• HY-17506R

  Azithromycin (Standard)	Inhibitor
  Azithromycin (Standard) is the analytical standard of Azithromycin. This product is intended for research and analytical applications. Azithromycin is a macrolide antibiotic useful for the treatment of a number of bacterial infections.

• HY-100593

  Spiramycin	Inhibitor	98.56%
  Spiramycin (Rovamycin) is a macrolide antibiotic produced by Streptomyces ambofaciens with against bacteria and Toxoplasma gondii activities, and also has antiparasitic effect. Spiramycin is composed of a 16-member lactone ring, on which three sugars (mycaminose, forosamine, and mycarose) are attached[1][2].

• HY-136497

  Coenzyme FO		99.06%
  Coenzyme FO, a deazaflavin chromophore, acts as an important hydride acceptor/donor in the central methanogenic pathway[1][2].

• HY-118697

  N-dodecanoyl-L-Homoserine lactone
  N-dodecanoyl-L-Homoserine lactone (C12-HSL) is a quorum sensing (QS) signaling molecule. N-dodecanoyl-L-Homoserine lactone (C12-HSL) aptamers blocks qurom sensing and inhibits biofilm formation in Pseudomonas aeruginosa[1].

• HY-N2510R

  Myristicin (Standard)	Inhibitor
  Myristicin (Standard) is the analytical standard of Myristicin. This product is intended for research and analytical applications. Myristicine is an orally bioavailable serotonin receptor antagonist and weak monoamine oxidase (MAO) inhibitor. Myristicine also exerts anti-cancer effects on gastric cancer cells by inhibiting the EGFR/ERK signaling pathway. Myristicine is the main component of nutmeg essential oil and has anti-cancer, anti-proliferative, antibacterial, anti-inflammatory and apoptosis-inducing effects. Myristicine abuse can produce hallucinogenic effects, organ damage, etc[1][2][3][4].

• HY-21745

  MurA-IN-4	Inhibitor
  MurA-IN-4 has antibacterial activity and is a MurA inhibitor that inhibits bacterial cell wall synthesis[1].

• HY-16561S1

  Resveratrol-13C6	Inhibitor
  Resveratrol-13C6 is the 13C-labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator[1][2][3][4]. Resveratrol is a potent pregnane X receptor (PXR) inhibitor[5]. Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model[6]. Resveratrol increases production of NO in endothelial cells[7].

• HY-100180R

  Delpazolid (Standard)	Inhibitor
  4-Chlorosalicylic acid (Standard) is the analytical standard of 4-Chlorosalicylic acid. This product is intended for research and analytical applications. 4-Chlorosalicylic acid is a pharmaceutical intermediate. Inhibits monophenolase and diphenolase activity with IC50s of 1.89 mM and 1.10 mM. Potent antimicrobial activity. Against E. coli with the MIC of 250 μg/mL and with the MBC of 500 μg/mL.

• HY-29268

  β-Carboline-1-carboxylic acid	Inhibitor
  β-Carboline 1-carboxylic acid is a β-carboline alkaloid with anti-inflammatory, antifibrotic, antitumor and antibacterial activities. β-Carboline 1-carboxylic acid is the cAMP phosphodiesterase (IC50: 96 µM) and indoleamine 2, 3-dioxygenase (IDO) inhibitor. β-Carboline 1-carboxylic acid is cytotoxic to tumor cells. β-Carboline 1-carboxylic acid inhibits inflammation through the NF-κb/p65 pathway and can reverse epithelial-mesenchymal transition (EMT). In addition, β-Carboline 1-carboxylic acid has strong inhibitory activity against S. aureus (IC50: 47.70 μg/mL) and E. coli (IC50: 19.17 μg/mL)[1][2][3][4].

• HY-10882

  Clotrimazole	Inhibitor	99.91%
  Clotrimazole is an imidazole derivative, an antifungal compound and is a CYP (cytochrome P450) inhibitor. Clotrimazole has antibacterial activity.

• HY-P5057A

  5-FAM-LL-37 TFA	Inhibitor
  5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy[1].

• HY-P10209

  Cilagicin	Inhibitor
  Cilagicin, a dodeca-lipodepsipeptide, is a Gram-positive active antibiotic. Cilagicin has a dual polyprenyl phosphate binding mechanism that impedes resistance development[1].

• HY-B1596

  Ceftizoxime	Inhibitor	99.90%
  Ceftizoxime is a bacterial inhibitor which acts by interfering with bacterial cell wall synthesis and inhibiting cross-linking of the peptidoglycan.

• HY-152097

  (S)-ZG197	Inhibitor
  (S)-ZG197 is a highly selective Staphylococcus aureus Caseinolytic protease P (SaClpP) activator with an EC50 of 1.4 μM[1].

• HY-P5718

  Brevinin-1PMa	Inhibitor
  Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity[1].

• HY-B0554

  Norethindrone		99.37%
  Norethindrone is a female progestin approved by FDA for the treatment of endometriosis, uterine bleeding caused by abnormal hormone levels, and secondary amenorrhea.

• HY-N3074

  Hexahydrofarnesyl acetone	Inhibitor
  Hexahydrofarnesyl acetone (6,10,14-Trimethyl-2-pentadecanone) is a oral active sesquiterpene with oral activity, exhibiting antibacterial, anti-inflammatory, and anticancer properties, and is used in pain relief research[1][2][3].

• HY-106922

  Sanfetrinem	Inhibitor
  Sanfetrinem (GV104326) is a β-lactamase-stable antibiotic. Sanfetrinem has broad-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria[1].

• HY-14648S

  Dexamethasone-d5	Inhibitor
  Dexamethasone-d5 is the deuterium labeled Dexamethasone. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses[1][2].

• HY-W004056

  4-Methoxyphenethyl alcohol	Inhibitor
  4-Methoxyphenethyl alcohol, an aromatic alcohol, is the major component in the anise-like odour produced by Amorphophallus. 4-Methoxyphenethyl alcohol can inhibits the protein, RNA and DNA synthesis in Escherichia coli[1].

• HY-B0643

  Dirithromycin	Inhibitor
  Dirithromycin (LY237216), a derivative of Erythromycin, is a potent and orally active semi-synthetic macrolide antibiotic. Dirithromycin is active against gram-positive bacteria, Legionella spp., Helicobacter pylori, and Chlamydia trachomatis[1][2].

• HY-121195

  Apalcillin	Inhibitor
  Apalcillin (PC-904) in combination with Ro 48-1220, a penam sulfone β-lactamase inhibitor, demonstrated broad-spectrum activity against gram-negative aerobic and anaerobic bacteria, excluding Klebsiella oxytoca. It exhibited potent activity against β-lactamase-producing Moraxella catarrhalis, Haemophilus influenzae, and Neisseria gonorrhoeae, with effective MICs (11 μg/mL). The combination also inhibited Pseudomonas aeruginosa, Stenotrophomonas maltophilia, and Acinetobacter species at low MICs (0.25 to 4 μg/mL). However, its efficacy against oxacillin-resistant staphylococci and certain gram-positive organisms was limited. Apalcillin/Ro 48-1220 showed comparable efficacy to piperacillin/tazobactam against some extended-spectrum β-lactamase-producing Escherichia coli but was less effective against SHV-type β-lactamases[1].

• HY-N2229

  Rhapontigenin	Inhibitor	99.66%
  Rhapontigenin is a natural analog of resveratrol with anticancer, antioxidant, antifungal and antibacterial activities. Rhapontigenin is amechanism-based, potent and selective cytochrome P450 1A1?inactivator (IC50 ?= 400 nM). Rhapontigenin exhibits 400-fold and 23-fold selectivity for P450 1A1 over P450 1A2 and P450 1B1, respectively[1].

• HY-126787

  17-Hydroxyventuricidin A	Inhibitor
  17-Hydroxyventuricidin A (YP-02259L-C) is an antimicrobial compound.17-Hydroxyventuricidin A inhibits the growth of the two tested filamentous fungi (Verticillium dahlia and Fusarium sp.) and of Candida tropicalis R2 CIP203[1].

• HY-10586R

  5-Azacytidine (Standard)	Inhibitor
  5-Azacytidine (Standard) is the analytical standard of 5-Azacytidine. This product is intended for research and analytical applications. 5-Azacytidine (Azacitidine; 5-AzaC; Ladakamycin) is a nucleoside analogue of cytidine that specifically inhibits DNA methylation. 5-Azacytidine is incorporated into DNA to covalently trap DNA methyltransferases and contributes to reverse epigenetic changes[1][2]. 5-Azacytidine induces cell autophagy[4].

• HY-136824

  Napyradiomycin A1	Inhibitor
  Napyradiomycin A1 is one enantioselective compound of napyradiomycins. napyradiomycins are an intriguing family of halogenated natural products with activity against several tumor cell lines as well as some bacterial strains[1].

• HY-B0479R

  Thiamphenicol (Standard)	Inhibitor
  Thiamphenicol (Standard) is the analytical standard of Thiamphenicol. This product is intended for research and analytical applications. Thiamphenicol (Thiophenicol), a methyl-sulfonyl derivative of Chloramphenicol, is a broad-spectrum antimicrobial antibiotic. Thiamphenicol acts by binding to the 50S ribosomal subunit, leading to inhibition of protein synthesis and bacteriostatic effect (against Gram-negative, Gram-positive aerobic and anaerobic bacteria)[1][2].

• HY-P10396

  Elf18	Inhibitor	99.28%
  Elf18 is the bacterial N-terminal fragment of Elongation Factor Thermus (EF-Tu). Elf18 is recognized by pattern recognition receptors (PRRs) as a pathogen-associated molecular pattern (PAMP), and thus induces immune response in Arabidopsis[1].

• HY-B2232

  Benzalkonium (chloride) (51% in water)	Inhibitor
  Benzalkonium (Alkyldimethylbenzylammonium) chloride (51% in water) is a potent anti-microbial agent, used as a preservative in eye drops.

• HY-P1695

  Cinnamycin	Inhibitor
  Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) [1].

• HY-P5556

  KAMP-19	Inhibitor
  KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. aeruginosa. [1].

• HY-146003

  FAAL-IN-1	Inhibitor
  FAAL-IN-1 (compound 32) is a selective inhibitor of fatty acyl-AMP ligase (FAAL), with a Ki of 0.7 μM for FAAL28. FAAL-IN-1 shows antimycobacterial activity[1].

• HY-N2512

  1-Monomyristin	Inhibitor
  1-Monomyristin, extracted from Serenoa repens, inhibits the hydrolysis of 2-oleoylglycerol (IC50=32 μM) and fatty acid amide hydrolase (FAAH) activity (IC50=18 μM). 1-Monomyristin shows antibacterial activity against Staphylococcus aureus and Aggregatibacter actinomycetemcomitans and also antifungal activity against Candida albicans[1][2][3].

• HY-118773R

  MreB Perturbing Compound A22 (hydrochloride) (Standard)	Inhibitor
  Aminoiminomethanesulphinic acid (Standard) is the analytical standard of Aminoiminomethanesulphinic acid. This product is intended for research and analytical applications. Aminoiminomethanesulphinic acid (Thiourea dioxide) is a biological material or organic compound that can be used in life science research[1][2].

• HY-P1459

  Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)	Inhibitor
  Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.

• HY-146171

  FabH-IN-1	Inhibitor
  FabH-IN-1 (compound 3f) is an inhibitor of bacterial 3-oxoacyl-[acyl-carrier-protein] synthase 3 (FabH) enzyme which is a broad-spectrum antimicrobial target. FabH-IN-1 is effective against gram-positive and gram-negative. FabH-IN-1 is also a good antioxidant[1].

• HY-N6689

  Destruxin A
  Destruxin A is a fungal cyclopeptide with insecticidal and antiviral activities. Destruxin A has a certain inhibitory effect on leukemia cells in vitro. Destruxin A can also specifically inhibit the innate immune response of Drosophila melanogaster, making the flies more susceptible to bacterial infections[1][2][3].

• HY-B1137R

  Ramifenazone (Standard)	Inhibitor
  Ramifenazone (Standard) is the analytical standard of Ramifenazone. This product is intended for research and analytical applications. Ramifenazone (Isopropylaminoantipyrine) is a pyrazole derivative and acts as a non-steroidal anti-inflammatory agent (NSAID). Ramifenazone has analgesic, antipyretic, anti-inflammatory and antimicrobial activities[1].

• HY-B0356AS

  Ciprofloxacin-d8 hydrochloride hydrate	Inhibitor
  Ciprofloxacin-d8 (hydrochloride hydrate) is the deuterium labeled Ciprofloxacin hydrochloride monohydrate. Ciprofloxacin hydrochloride monohydrate is a fluoroquinolone antibiotic, exhibiting potent antibacterial activity.

• HY-135659

  BSH-IN-1	Inhibitor
  BSH-IN-1 is a potent and covalent inhibitor of gut bacterial recombinant bile salt hydrolases (BSHs) with IC50s of 108 nM and 427 nM for B. longum BSH (Gram positive) and B. theta BSH (Gram negative), respectively[1].

• HY-N0315R

  Allicin (Standard)	Inhibitor

• HY-115843

  LL-D05139β	Inhibitor
  LL-D05139β is a potent antibacterial antibiotic and antitumor agent[1].

• HY-P1938

  Cyclo(L-Pro-L-Val)	Inhibitor	98.43%
  Cyclo(L-Pro-L-Val) is a 2,5-diketopiperazine, with toxic activity against phytopathogenic microorganisms (such as R. fascians LMG 3605). Cyclo(L-Pro-L-Val) shows toxicity similar to Chloramphenicol (HY-B0239) with comparable concentration. Cyclo(L-Pro-L-Val) can also inhibit gram-positive phytopathogenic bacterium. Cyclo(L-Pro-L-Val) has potential development as biopesticide[1].

• HY-N6725

  Sterigmatocystine	Inhibitor
  Sterigmatocystine is a precursor of aflatoxins and a mycotoxin produced by common mold strains from Aspergillus versicolor[1][2]. Sterigmatocystine, a inhibitor of G1 Phase and DNA synthesis, is used to inhibit p21 activity. Sterigmatocystine has teratogenic, and carcinogenic effects in animals[3].

• HY-133951

  4',6,7-Trimethoxyisoflavone	Inhibitor
  4',6,7-Trimethoxyisoflavone is an isoflavone with antimicrobial activities against a wide range of bacteria and fungi. 4',6,7-Trimethoxyisoflavone also has antioxidant effects[1].

• HY-W087988R

  3-Pentanol (Standard)	Inhibitor
  3-Pentanol (Standard) is an analytical reference standard of 3-Pentanol. 3-Pentanol is an active organic compound produced by plants and is a component of insect-released pheromones. 3-Pentanol can trigger plant immunity against microbial pathogens and pests in crops by activating the SA and JA signaling pathways.

• HY-147097A

  EDA-DA TFA
  EDA-DA is a N-terminally tagged dipeptide probe, can be used to label Peptidoglycan (PG) of bacteria. EDA-DA is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups[1].

• HY-B0734A

  Cefotiam hydrochloride	Inhibitor
  Cefotiam (SCE-963) hydrochloride is a parenteral cephalosporin antibiotic. Cefotiam hydrochloride has broad-spectrum activity against Gram-positive and Gram-negative bacteria[1][2].

• HY-N7141

  Spiramycin I		98.09%
  Spiramycin I is a macrolide antibiotic and antiparasitic[1].

• HY-B1381R

  Cefixime (Standard)	Inhibitor
  Cefixime (Standard) is the analytical standard of Cefixime. This product is intended for research and analytical applications. Cefixime (FR-17027) is an orally active antibiotic and a third generation cephalosporin antibiotic, useful for the treatment of a number of bacterial infections[1][2].

• HY-N11054

  Psoracorylifol B	Inhibitor
  Psoracorylifol B is a Helicobacter pylori inhibitor with MICs of both 12.5 μg/mL against H. pylori ATCC 43504 and H. pylori SS1[1].

• HY-P5803A

  Pardaxin P5 TFA	Inhibitor
  Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM[1].

• HY-N3602

  Cleroindicin F	Inhibitor
  Cleroindicin F ((-)-Rengyolone), a cleroindicin, is an antimicrobial agent. Cleroindicin F shows relatively high anticandidal activity against Candida strains with a MIC value down to 12.5 µg/mL[1].

• HY-105231

  Bryostatin 1
  Bryostatin 1 is a natural macrolide isolated from the bryozoan Bugula neritina and is a potent and central nervous system (CNS)-permeable PKC modulator. Bryostatin 1 binds to the isolated C1 domain of Munc13-1 and the full-length Munc13-1 protein with Kis of 8.07 nM and 0.45 nM, respectively. Bryostatin 1 has anti-cancer, anti-inflammatory, neuroprotective, anti-HIV-1 infection properties[1][2][3][4].

• HY-137960

  O,O-Dimethyl-cannabigerol	Inhibitor	99.86%
  O,O-Dimethyl-cannabigerol is a natural product from Cannabis sativa. O,O-Dimethyl-cannabigerol has an antibacterial effect on drug-resistant strains of Staphylococcus aureus (MIC ranging from 1 to 2 μg/mL)[1]. O,O-Dimethyl-cannabigerol is a nonpsychoactive constituent[2][3].

• HY-B0343A

  Sarafloxacin hydrochloride	Inhibitor	98.14%
  Sarafloxacin (hydrochloride) (A-56620 (hydrochloride)) is a quinolone antibiotic agent.

• HY-W014338

  Phenyl(9H-purin-6-yl)amine	Inhibitor
  Phenyl(9H-purin-6-yl)amine is an antibacterial compound with the activity of inhibiting bacterial growth. The application of phenyl(9H-purin-6-yl)amine can be used to develop new antibacterial compounds. Phenyl(9H-purin-6-yl)amine has shown potential inhibitory effects in medical research.

• HY-120504

  N-Acetyltyramine	Inhibitor	98.90%
  N-Acetyltyramine is a quorum-sensing inhibitor (QSI) compound produced by V. alginolyticus M3-10. N-Acetyltyramine is capable of inhibiting the QS of C. violaceum ATCC 12472. N-acetyltyramine reverses resistance in Doxorubicin-resistant leukemia P388 cells[1][2].

• HY-P3328A

  MDP1 acetate	Inhibitor	98.66%
  MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa[1].

• HY-105113

  Cefluprenam	Inhibitor
  Cefluprenam is a β-lactam antibiotic with broad-spectrum antibacterial activity[1].

• HY-N6688

  Verruculogen	Inhibitor
  Verruculogen is a toxin produced mainly by Penicillium and Aspergillus spp. and causes severe tremors in affected animals. Verruculogen inhibits Ca2+-activated K+ channels. Verruculogen is an M phase inhibitor of the mammalian cell cycle[1][2][3].

• HY-B0281AS

  Ranitidine-d6 hydrochloride	Inhibitor
  Ranitidine-d6 (hydrochloride) is the deuterium labeled Ranitidine hydrochloride. Ranitidine hydrochloride is a potent, selective and orally active histamine H2-receptor antagonist with an IC50 of 3.3 μM that inhibits gastric secretion. Ranitidine hydrochloride is a weak inhibitor of CYP2C19 and CYP2C9[1][2].

• HY-N14911

  Actinoplanone A	Inhibitor
  Actinoplanone A is a polycyclic xanthone antibiotic. Actinoplanone A has strong antimicrobial activities against bacteria and the rice blast fungus. Actinoplanone A is cytotoxic to various tumor cells and has an inhibitory effect on DNA synthesis[1].

• HY-B0449R

  Methacycline (hydrochloride) (Standard)	Inhibitor
  Methacycline (hydrochloride) (Standard) is the analytical standard of Methacycline (hydrochloride). This product is intended for research and analytical applications. Methacycline hydrochloride is a tetracycline antibiotic and can inhibits bacterial protein synthesis. Methacycline hydrochloride is a potent epithelial-mesenchymal transition (EMT) inhibitor. Methacycline hydrochloride blocks EMT in vitro and fibrogenesis in vivo without directly affecting TGF-β1 Smad signaling. Methacycline hydrochloride is an antimicrobial and has the potential for pulmonary fibrosis[1].

• HY-B0147B

  Pefloxacin mesylate dihydrate	Inhibitor
  Pefloxacin mesylate dehydrate is a an antibacterial agent and prevents bacterial DNA replication by inhibiting DNA gyrase (topoisomerse) Target: DNA gyrase Pefloxacin is a synthetic chemotherapeutic agent used to treat severe and life-threatening bacterial infections.

• HY-169587

  Protein kinase G inhibitor-3	Inhibitor
  Protein kinase G inhibitor-3 (Compound 177) is an inhibitor of mycobacterial serine/threonine protein kinases. Protein kinase G inhibitor-3 can be used in the research of diseases related to mycobacterial infections[1].

• HY-15537

  Tilbroquinol	Inhibitor	98.02%
  Tilbroquinol is an orally active antiparasite agent, can be used in study of amoebiasis. tilbroquinol is also used against Vibrio cholera[1].

• HY-15739

  Ansamitocin P-3	Inhibitor
  Ansamitocin P-3 (Antibiotic C 15003P3) is a microtubule inhibitor. Ansamitocin P-3 is a macrocyclic antitumor antibiotic.

• HY-124084A

  SW203668 TFA	Inhibitor
  SW203668 TFA is a benzothiazole compound, shows anti-tumor activity against lung cancer cell lines (IC50=0.022-0.116 μM)

• HY-W004520R

  Phenazine (methylsulfate) (Standard)	Inhibitor

• HY-P5204

  Enterocin Hybrid 1	Inhibitor
  Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus[1].

• HY-148077

  Phosphoglycolohydroxamic acid	Inhibitor
  Phosphoglycolohydroxamic acid is a potent aldolase and triose-phosphate isomerase inhibitor. Phosphoglycolohydroxamic acid can be used in the research of antibacterial and antifungal area[1][2].

• HY-124679

  DS86760016	Inhibitor	99.25%
  DS86760016 is a potent leucyl-tRNA synthetase (LeuRS) inhibitor with activity against multidrug-resistant (MDR) Gram-negative bacteria, such as Escherichia coli, Klebsiella pneumoniae, and Pseudomonas aeruginosa. DS86760016 inhibits LeuRS enzymes from Escherichia coli, Pseudomonas aeruginosa, and Acinetobacter baumannii, with IC50s of 0.38, 0.62, and 0.16 μM, respectively[1][2].

• HY-N1820

  3α-Akebonoic acid	Inhibitor
  3α-Akebonoic acid is a α-glucosidase inhibitor with an IC50 value of 0.035 mM. 3α-Akebonoic acid shows antibacterial activity and cytotoxicity[1].

• HY-B0200A

  Cephalexin hydrochloride	Inhibitor	99.77%
  Cephalexin (Cefalexin) hydrochloride is a potent, orally active new semisynthetic cephalosporin antibiotic with a broad antibacterial spectrum. Cephalexin (Cefalexin) hydrochloride has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria. Cephalexin (Cefalexin) hydrochloride targets penicillin-binding proteins (PBPs) to inhibit bacterial cell wall assembly. Cephalexin (Cefalexin) hydrochloride is used for the research of pneumonia, strep throat, and bacterial endocarditis, et al[1][2].

• HY-130323

  13-HPOT	Inhibitor
  13-HPOT, a linolenic fatty acid hydroperoxide, is an antibacterial agent. 13-HPOT has a strong dose response effect on three plant pathogen gram negative bacteria: Pectobacterium carotovorum, Pseudomonas syringae and Xanthomonas translucens. 13-HPOT can interact with the lipid representative of the inner bacterial plasma membrane[1].

• HY-N13987

  Arylomycin B7	Inhibitor
  Arylomycin B7 is a lipohexapeptide antibiotic against Gram-positive bacteria[1].

• HY-N7188

  CJ-21,058	Inhibitor
  CJ-21,058 is a potent SecA inhibitor with an IC50 value of 15 µg/mL. CJ-21,058 inhibits ATP-dependent translocation of precursor proteins across a bacterial cell membrane. CJ-21,058 shows antibacterial activity against Gram-positive bacteria[1].

• HY-117488

  (S)-Grepafloxacin	Control
  (S)-Grepafloxacin ((S)-OPC-17116) is the S-enantiomer of Grepafloxacin (HY-A0147)[1].

• HY-136439R

  4-Epianhydrotetracycline (hydrochloride) (Standard)	Inhibitor
  4-Epianhydrotetracycline (hydrochloride) (Standard) is the analytical standard of 4-Epianhydrotetracycline (hydrochloride). This product is intended for research and analytical applications. 4-Epianhydrotetracycline hydrochloride is a major intermediate product of Tetracycline (HY-A0107). 4-Epianhydrotetracycline hydrochloride shows lethal effects and induces cell apoptosis of zebrafish embryos. 4-Epianhydrotetracycline hydrochloride inhibits Shewanella, E. coli and P. aeruginosa with MIC values of 2, 1 and 64 mg/L, respectively[1].

• HY-N3515

  Multicaulisin	Inhibitor
  Multicaulisin, a new Diels-Alder type adduct from Morus multicaulis roots, potently effects against Staphylococcus aureus (MRSA) isolates. Multicaulisin is an antibacterial agent and has the potential for MRSA infections research[1][2].

• HY-N1394

  p-Anisic acid	Inhibitor	99.76%
  p-Anisic acid (4-Methoxybenzoic acid) is an orally available tyrosinase inhibitor that has antioxidant, anti-anxiety, anti-inflammatory, anti-tumor, anti-diabetic, and preservative properties. p-Anisic acid can be used as a preservative in the cosmetics field[1][2][3][4].

• HY-P0261

  Indolicidin	Inhibitor
  Indolicidin is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.

• HY-115399A

  N-3-Oxo-hexadecanoyl-L-Homoserine lactone
  N-3-Oxo-hexadecanoyl-L-Homoserine lactone is a signaling molecule to coordinate group behaviors at high densities in many bacteria. N-3-Oxo-hexadecanoyl-L-Homoserine lactone adsorbs to and promotes the remodeling of lipid membranes in ways that could underpin cell-cell or host-cell interactions[1].

• HY-168729

  Antibacterial agent 256	Inhibitor
  Antibacterial agent 256 (Compound C09) is an inhibitor for type I signal peptidase (SPase I). Antibacterial agent 256 inhibits gram-positive bacteria, that inhibits S. aureus ATCC 29213, E. faecium QF31, E. faecalis SF23-1 and S. suis P1/7, with MIC of 1-16 μg/mL. Antibacterial agent 256 exhibits cytotoxicity in cancer cell HEp-2 and Caco-2 with CC50 of 14.65 μg/mL and 21.93 μg/mL. Antibacterial agent 256 exhibits a hemolytic activity on mouse RBCs, with an HC50 of 13.29 μg/mL. Antibacterial agent 256 ameliorates the MRSA skin infection in mouse model[1].

• HY-100381

  Nigericin sodium salt	Inhibitor
  Nigericin sodium salt is an antibiotic derived from Streptomyces hygroscopicus that act as a K+/H+ ionophore, promoting K+/H+ exchange across mitochondrial membranes. Nigericin sodium salt is a NLRP3 activator. Nigericin sodium salt shows promising anti-cancer activities through decreasing intracellular pH (pHi), and inactivation of Wnt/β-catenin signals. Nigericin sodium salt induces pyroptosis through caspase 1/GSDMD in TNBC[1][2][3][4][5][6][7].

• HY-135453

  (-)-Pinocembrin	Inhibitor
  (-)-Pinocembrin exhibits anti-mycobacterium activity against mycobacteriuum tuberculosis H37Ra with an IC50 value of 1.11 mg/mL in dormant phase and 1.21 mg/mL in active phase, respectively. (-)-Pinocembrin has potent antiproliferative activity with IC50 values of 1.88-11.00 mg/mL against THP-1, A549, Panc-1, HeLa and MCF7 cell lines[1].

• HY-N0711R

  Carvacrol (Standard)	Inhibitor
  Carvacrol (Standard) is the analytical standard of Carvacrol. This product is intended for research and analytical applications. Carvacrol is an orally active monoterpenic phenol that can be extract from an abundant number of aromatic plants, including thyme and oregano, possessing antioxidant, antibacterial, antifungal, anticancer, anti-inflammatory, hepatoprotective, spasmolytic, and vasorelaxant properties. Carvacrol also causes cell cycle arrest in G0/G1, downregulates Notch-1, and Jagged-1, and induces apoptosis. Carvacrol is used in low concentrations as a food flavoring ingredient and preservative, as well as a fragrance ingredient in cosmetic formulations[1][2].

• HY-137938

  Radicinol	Inhibitor
  Radicinol is a metabolite of cochliobolus lunata, and absolute stereochemistry of radicinin[1].

• HY-N7102

  Ceftiofur	Inhibitor	99.06%
  Ceftiofur is a semisynthetic antibiotic, with activity against various gram-positive and gram-negative, aerobic and anaerobic bacteria encountered by domestic animals[1].

• HY-N7114

  Chloramphenicol succinate	Inhibitor
  Chloramphenicol succinate is a proagent of Chloramphenicol, with Haemotoxicity. Chloramphenicol succinate also is an antibiotic. Chloramphenicol succinate is a competitive substrate and inhibitor of succinate dehydrogenase (SDH) that is the possible reason for its toxicity[1][2][3][4].

• HY-B0535S2

  Ethambutol-d8	Inhibitor
  Ethambutol-d8 is deuterium labeled Ethambutol.

• HY-16102R

  Bismuth subcitrate (potassium) (Standard)	Inhibitor
  7-Ethoxy-4-methylcoumarin (Standard) is the analytical standard of 7-Ethoxy-4-methylcoumarin. This product is intended for research and analytical applications. 7-Ethoxy-4-methylcoumarin is a coumarin derivative and can be used as a substrate probe of mammalian cytochromes P450 1A1, 2B4 and 2B6[1][2].

• HY-W777995

  Clindamycin B	Inhibitor
  Clindamycin B is a derivative of Clindamycin (HY-B1455)[1].

• HY-W040298R

  Ciprofloxacin (lactate) (Standard)	Inhibitor
  Ciprofloxacin (lactate) (Standard) is the analytical standard of Ciprofloxacin (lactate). This product is intended for research and analytical applications. Ciprofloxacin (Bay-09867) lactate is a potent, orally active topoisomerase IV inhibitor. Ciprofloxacin lactate induces mitochondrial DNA and nuclear DNA damage and lead to mitochondrial dysfunction, ROS production. Ciprofloxacin lactate has anti-proliferative activity and induces apoptosis. Ciprofloxacin lactate is a fluoroquinolone antibiotic, exhibiting potent antibacterial activity[1][2][3][4].

• HY-167812

  Trimethylsilyl-L-(+)-rhamnose	Inhibitor
  Trimethylsilyl-L-(+)-rhamnose is a chemically modified version of the natural sugar rhamnose that has activity in studying the role of rhamnose in bacterial cell walls. Trimethylsilyl-L-(+)-rhamnose can be used to explore the composition of bacterial cell walls and their biological functions. Trimethylsilyl-L-(+)-rhamnose can help scientists gain insight into bacterial growth and resistance mechanisms.

• HY-108971

  Demecycline	Inhibitor
  Demecycline, a tetracycline antibiotic, is the C6-demethylated derivative of Tetracycline (HY-A0107) against bacterial infections including pneumonia and other respiratory tract infections[1].

• HY-P5706

  HG2	Inhibitor
  HG2 is a fast-acting antimicrobial peptide. HG2 shows anti-biofilm and anti-inflammatory activities. HG2 is active against Gram-positive pathogens, especially against MRSA strains (MIC: 16-32?μg/mL). HG2 can bind to bacterial lipids and reduces ATP concentration in S. aureus MRSA USA300 cells[1].

• HY-N5168

  Argimicin B	Inhibitor
  Argimicin B is an antibiotic that can be isolated from Sphingomonas sp.. Argimicin B exhibits algicidal activity against a variety of toxic cyanobacteria with MIC of low micromolar levels[1].

• HY-122260

  S-25932	Inhibitor
  S-25932 is a potent 4-quinolones antibacterial agent. S-25932 shows broad gram-negative antibacterial activity. S-25932 shows inhibition for Enterobacter aerogenes, Enterobacter addlomerans, Enterobacter coloacae, Escherichia coli with MIC90 values of 1.0, 2.0, 1.0, 0.25 µg/mL, respectively[1].

• HY-B0330AR

  Levofloxacin (hydrate) (Standard)	Inhibitor
  Levofloxacin (hydrate) (Standard) is the analytical standard of Levofloxacin (hydrate). This product is intended for research and analytical applications. Levofloxacin hydrate (Levofloxacin hemihydrate) is an orally active antibiotic and is active against both Gram-positive and Gram-negative bacteria. Levofloxacin hydrate inhibits the DNA gyrase and topoisomerase IV. Levofloxacin hydrate can be used for chronic periodontitis, airway inflammation and BK Viremia research. Levofloxacin hydrate shows anti-orthopoxvirus activity[1][2][3][4].

• HY-P0135

  Penta lysine	Inhibitor
  Penta lysine is an antibacterial agent, that inhibits E. coli, A. baumannii, P. aeruginos, S. aureus, and B. subtilis, with MIC of 1.1-18 μM[1].

• HY-168705

  Anti-MRSA agent 20	Inhibitor
  Anti-MRSA agent 20 (Compound a4) is an anti-microbial agent (MIC: < 0.03125 μg/mL) against MRSA). Anti-MRSA agent 20 binds to the ribosomal peptidyl transferase center and inhibits bacterial survival by inhibiting MRSA toxin synthesis and bacterial division. Anti-MRSA agent 20 significantly reduces the MRSA load in the lungs and attenuates lung injury in the MRSA-infected mice (ED50 = 6.48 mg/kg)[1].

• HY-160922

  BAY 249716	Inhibitor	99.03%
  BAY 249716 stabilizes all three p53 protein variants. BAY 249716 also has antitubercular activity (IC90: <0.10 μg/mL for Tuberculosis)[1][2].

• HY-P5711

  NEMURI	Inhibitor
  NEMURI is an antimicrobial peptide with sleep-promoting effect[1].

• HY-P5611

  Maximin 7
  Maximin 7 is an antimicrobial peptide derived from toad Bombina maxima[1].

• HY-N6643

  Rubropunctamine	Inhibitor
  Rubropunctamine is a redMonascus pigment. Not only Rubropunctamine exerts antibiotic action against bacteria but also against some yeast and filamentous fungi strains. Rubropunctamine has potential embryotoxicity and teratogenicity[1].

• HY-13579

  BTZ043	Inhibitor	99.51%
  BTZ043 is an inhibitor of decaprenyl-phosphoribose-epimerase (DprE1), with MICs of of 2.3 nM and 9.2 nM for M. tuberculosis H37Rv and Mycobacterium smegmatis, respectively.

• HY-107966A

  Heparin calcium (MW 3600-5000)	Inhibitor
  Heparin (Nadroparin) calcium (MW 3600-5000) is an anticoagulant which binds reversibly to antithrombin III (ATIII) to form a heparin-antithrombin III complex. The complex binds to and irreversibly inactivates thrombin and other activated clotting factors IX, X, XI, and XII and prevents the transformation of fibrinogen to fibrin[1][2].

• HY-12820R

  Sibofimloc (Standard)	Inhibitor

• HY-113557

  DNAC-1
  DNAC-1 is a potent antibacterial agent. DNAC-1 enhances β-lactam activity against Gram positive and Gram negative pathogens[1].

• HY-146263

  ThrRS-IN-3
  ThrRS-IN-3 (compound 36j) is a highly potent threonyl-tRNA synthetase (ThrRS) inhibitor, with an IC50 value of 19 nM and a Kd of 34 nM for Salmonella enterica ThrRS. ThrRS-IN-3 has antibacterial activities[1].

• HY-B2072A

  Cephaloridine hydrate	Inhibitor	99.79%
  Cephaloridine hydrate is a broad-spectrum antibacterial antibiotic. Cephaloridine has certain dose-related nephrotoxicity[1][2].

• HY-B0519AR

  Tylosin (Standard)	Inhibitor
  Tylosin (Standard) is the analytical standard of Tylosin. This product is intended for research and analytical applications. Tylosin (Tylosin A) is a macrolide antibiotic found naturally as a fermentation product of Streptomyces fradiae. Tylosin exerts potent antimicrobial activity against Gram-positive bacteria. Tylosin is widely used as a feed additive for promoting animal growth. Tylosin is used for veterinary purposes against bacterial dysentery and respiratory diseases in poultry, pigs and cattle[1][2][3].

• HY-17525

  Bethoxazin	Inhibitor
  Bethoxazin(Bethoguard) is a new broad spectrum industrial microbicide with applications in material and coating preservation.

• HY-16566

  Kanamycin	Inhibitor	99.97%
  Kanamycin (Kanamycin A) is an orally active antibacterial (gram-negative/positive bacteria) agent, inhibits translocation and causes misencoding by binding to the 70 S ribosomal subunit. Kanamycin shows good inhibitory activity to both M. tuberculosis (sensitive and drug-resistant ) and K. pneumonia, which can be used in studies of tuberculosis and pneumonia[1][2][3][4].

• HY-B1703S

  Nifursol-13C6	Inhibitor	99.60%
  Nifursol-13C6 is the 13C6 labeled Nifursol. Nifursol is a potent and orally active veterinary antibiotic for the prevention of histomoniasis. Nifursol rapidly metabolizes to form the metabolic marker 3,5-dinitrosalicyclic acid hydrazide (DNSAH) which can persist for a long time. Nifursol is widely used for the research of Escherichia Gastroenteropathy in poultry, fowl and aquatic animal.

• HY-129385

  Linustatin
  Linustatin is a cyanogenic glycoside that can be isolated from linseed meal[1].

• HY-122356A

  Ambazone	Inhibitor
  Ambazone is an orally active membrane active antitumor agent. Ambazone also shows antibacterial and weak antiviral activities[1].

• HY-17422D

  Acyclovir hydrochloride	Inhibitor
  Acyclovir (Aciclovir) hydrochloride is a potent, orally active antiviral agent. Acyclovir hydrochloride has antiherpetic activity with IC50 values of 0.85 μM and 0.86 μM for HSV-1 and HSV-2, respectively. Acyclovir hydrochloride induces cell cycle perturbation and apoptosis. Acyclovir hydrochloride prevents bacterial infections during induction therapy for acute leukaemia[1][2][3][4].

• HY-108877

  Cefepime hydrochloride	Inhibitor
  Cefepime hydrochloride is a cephalosporin antibiotic agent. Cefepime hydrochloride has inhibitory activity against human serum paraoxonase-1 (hPON1) with an IC50 value of 21.115 mM[1].

• HY-B0821R

  Pymetrozine (Standard)	Inhibitor
  Pymetrozine (Standard) is the analytical standard of Pymetrozine. This product is intended for research and analytical applications. Pymetrozine is a feeding inhibitor of Homoptera, in preventing transmission of cauliflower mosaic caulimovirus by the aphid species Myzus persicae (Sulzer).

• HY-P1763

  Urechistachykinin II	Inhibitor
  Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect[1][2].

• HY-116992R

  Chloroneb (Standard)	Inhibitor
  Chloroneb (Standard) is the analytical standard of Chloroneb. This product is intended for research and analytical applications. Chloroneb (Demosan) is a pesticide with fungicidal and plant-protective activities. Chloroneb can be used to detect organochlorine pesticide residues, showing good selectivity, stability and reproducibility. Chloroneb has been applied to the detection of licorice, cucumber, river water and soil samples with satisfactory results[1].

• HY-127155

  Kigamicin C	Inhibitor
  Kigamicin C is an anti-tumor antibiotic that selectively kills pancreatic cancer PANC-1 cells only in nutrient-poor conditions. Kigamicin C has antimicrobial activity against Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-151339

  Antitubercular agent-31	Inhibitor
  Antitubercular agent-31 (Compound 2) is an antitubercular agent with an MIC of 0.03 μM against M. tuberculosis H37Rv. Antitubercular agent-31 also inhibits DprE1 with an IC50 of 1.1 μM[1].

• HY-141442

  Dihydronovobiocin	Inhibitor
  Dihydronovobiocin is a bacterial inhibitor and ATPase inhibitor that can bind to GyrB. Dihydronovobiocin can be used to study the interaction between coumarin antibiotics (such as Novobiocin, Chlorobiocin, and Coumermycin) and DNA gyrase. Dihydronovobiocin also has the potential to study bacterial infections[1][2].

• HY-B0510S

  Trimethoprim-d9	Inhibitor	98.81%
  Trimethoprim-d9 is the deuterium labeled Trimethoprim. Trimethoprim is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim has the potential for urinary tract infections, Shigellosis and Pneumocystis pneumonia treatment[1][2][3].

• HY-P10559

  (RXR)4XB	Inhibitor
  (RXR)4XB is a cell-penetrating peptide, that binds the phosphorodiamidate morpholino oligomers (PMOs), forms peptide-conjugated PMOs (PPMOs), and improves the delivery of PMO into bacterial cells. (RXR)4XB-PMO conjugate prevents the formation of biofilms, inhibits Pseudomonas aeruginosa with MIC50 of 0.5 to 16 μM, and reduces the bacterial burden in mouse acute pneumonia models[1].

• HY-N6728

  Helvolic acid	Inhibitor	99.06%
  Helvolic acid (Fumigacin) is an antibiotic isolated from Xylaria sp, active against the Gram-positive bacteria[1].

• HY-144382

  Glutamate-5-kinase-IN-2
  Glutamate-5-kinase-IN-2 (compound 54) is a potent glutamate-5-kinase (G5K) inhibitor with an MIC (minimum inhibitory concentration) of 4.2 µM. Glutamate-5-kinase-IN-2 shows G5K inhibition by promotes conformational changes at the L-glutamate binding site. Glutamate-5-kinase-IN-2 has the potential for the research of anti-TB agents[1].

• HY-167816

  1,2-Diheneicosanoyl-sn-glycero-3-phosphocholine	Inhibitor
  1,2-Diheneicosanoyl-sn-glycero-3-phosphocholine (21:0 PC) is a surfactant with antibacterial activity. 1,2-Diheneicosanoyl-sn-glycero-3-phosphocholine can act in mucus to help prevent the spread of pathogens. 1,2-Diheneicosanoyl-sn-glycero-3-phosphocholine plays a protective role in biofilms, maintaining the health of organisms.

• HY-B0323R

  Sulfisoxazole (Standard)	Inhibitor
  Sulfisoxazole (Standard) is the analytical standard of Sulfisoxazole. This product is intended for research and analytical applications. Sulfisoxazole (Sulfafurazole) is an orally active endothelin receptor antagonist with IC50 values of 0.60 μM and 22 μM against endothelin receptor A and endothelin receptor B, respectively. Sulfisoxazole is a sulfonamide antibacterial agent with an oxazole substituent. Sulfisoxazole inhibits breast cancer exosome release by targeting endothelin receptor A[1][2].

• HY-155190

  Antitubercular agent-39	Inhibitor
  Antitubercular agent-39 (Compound P1) is a potent antitubercular agent. Antitubercular agent-39 is active against drug-resistant strains and drug-susceptible clinical isolates. Antitubercular agent-39 inhibits Mtb strain H37Rv with a MIC less than 1 μM[1].

• HY-120583

  (Rac)-LY 255262	Inhibitor
  (Rac)-LY 255262 is a pyrazolidinone-derivative that has antibacterial activity[1].

• HY-124237A

  N-Octanoyl-L-homoserine lactone	Inhibitor	99.58%
  N-octanoyl-L-Homoserine lactone is a small diffusible signaling molecule involved in quorum sensing, thereby controlling gene expression and affecting cellular metabolism. N-octanoyl-L-Homoserine lactone can be used for the infection prevention and regulation of virulence in cystic fibro.

• HY-12326B

  c-di-AMP diammonium		99.36%
  c-di-AMP diammonium is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP diammonium is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP diammonium acts as a potent mucosal adjuvant stimulating both humoral and cellular responses[1][2][3][4].

• HY-155107

  ND-011992	Inhibitor	98.26%
  ND-011992 is a reversible, selective quinazoline-type inhibitor targeting quinone reductases and quinol oxidases. ND-011992 inhibits respiratory complex I and bo3 oxidase in addition to bd-I and bd-II oxidases in E. coli strain BL21*Δcyo with the IC50 of 0.12, 2.47, 0.63 and 1.3 μM, respectively. ND-011992 can be used for tuberculosis study[1].

• HY-14879A

  Avibactam sodium	Inhibitor
  Avibactam sodium (NXL-104) is a covalent and reversible non-β-lactam β-lactamase inhibitor which inhibits β-lactamase TEM-1 and CTX-M-15 with IC50s of 8 nM and 5 nM, respectively[1].

• HY-21210

  6-Quinoxalinecarboxylic acid, 2,3-bis(bromomethyl)-	Inhibitor
  6-Quinoxalinecarboxylic acid, 2,3-bis(bromomethyl)-, derived from 2,3-Bis(bromomethyl)quinoxaline, shows antibacterial activity[1].

• HY-B0269R

  Rifapentine (Standard)	Inhibitor
  Rifapentine (Standard) is the analytical standard of Rifapentine. This product is intended for research and analytical applications. Rifapentine (DL 473) is an antibiotic used in tuberculosis research[1].

• HY-14865CR

  Omadacycline (hydrochloride) (Standard)	Inhibitor

• HY-14855B

  Tedizolid phosphate	Inhibitor	99.65%
  Tedizolid phosphate (TR-701FA) is a MAO-A and MAO-B inhibitor with activity against Gram-positive bacteria[1].

• HY-10844R

  Pretomanid (Standard)	Inhibitor
  Pretomanid (Standard) is the analytical standard of Pretomanid. This product is intended for research and analytical applications. Pretomanid (PA-824) is an antibiotic used for the research of multi-drug-resistant tuberculosis affecting the lungs. Pretomanid exhibits a sub-micromolar MIC against M. tuberculosis (MTB). The MIC values of PA-824 against a panel of MTB pan-sensitive and Rifampin mono-resistant clinical isolates range from 0.015 to 0.25 μg/mL.

• HY-162142

  BB2-50F	Inhibitor	99.52%
  BB2-50F is a potent and multi-targeting bioenergetic bactericidal inhibitor of M. tuberculosis and can sterilizes replicating and non-replicating M. tuberculosis. BB2-50F inhibits succinate oxidation, decreases the activity of the tricarboxylic acid (TCA) cycle, and results in succinate secretion from M. tuberculosis.[1]

• HY-139752

  Antibacterial agent 35	Inhibitor
  Antibacterial agent 35, an antibacterial agent, significantly lowers MIC value of antibacterial agent Ceftazidime[1].

• HY-B0875R

  Cefmenoxime (hydrochloride) (Standard)	Inhibitor
  Cefmenoxime (hydrochloride) (Standard) is the analytical standard of Cefmenoxime (hydrochloride). This product is intended for research and analytical applications. Cefmenoxime (SCE-1365) hydrochloride is a new semisynthetic cephalosporin antibiotic. Cefmenoxime has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria[1][2].

• HY-N7430

  3-O-Methylellagic acid	Inhibitor
  3-O-Methylellagic acid is a nature product that can be isolated from Myrciaria cauliflora, with anti-inflammatory activity. 3-O-Methylellagic acid shows an inhibitory effect on glucose transport assay. 3-O-Methylellagic acid has antibacterial activity, with a MIC of 32 μg/mL for Staph. Aureus ATCC 25923[1][2][3].

• HY-10394S1

  PNU-100766-d8	Inhibitor
  PNU-100766-d8 is deuterated labeled Linezolid (HY-10394). Linezolid (PNU-100766) is the first member of the class of oxazolidinone synthetic antibiotic. Linezolid acts by inhibiting the initiation of bacterial protein synthesis. Linezolid is used for the treatment of serious infections caused by Gram-positive bacteria that are resistant to several other antibiotics[1][2][3].

• HY-19081

  KB-5246	Inhibitor
  KB-5246 is a tetracyclic quinolone and displays antibacterial activities.

• HY-D2460

  Dextran-CY5.5
  Dextran-CY5.5 is a CY5.5 (HY-D0924) labeled Dextran (HY-112624) conjugate. CY5.5 is a Cyanine dye (The excitation wavelength is usually 673nm and the emission wavelength is 707nm) that can be used for the labeling of proteins, antibodies and small molecular compounds. Dextran has an inhibitory effect on thrombocyte aggregation and coagulation factors and is used as a plasma volume expander[1].

• HY-119529

  Jineol	Inhibitor	99.22%
  Jineol is a cytotoxic alkaloid from the centipede Scolopendra subspinipes. Jineol exhibits modest cytotoxic activity in vitro against the growth of human tumor cell lines[1].

• HY-15449

  Kaempferide	Inhibitor	99.80%
  Kaempferide is an orally active flavonol isolated from Hippophae rhamnoides L. Kaempferide has anticancer, anti-inflammatory, antioxidant, antidiabetic, antiobesity, antihypertensive, and neuroprotective activities. Kaempferide induces apoptosis. Kaempferide promotes osteogenesis through antioxidants and can be used in osteoporosis research[1][2][3][4][5][6].

• HY-W001189S

  1,3-Dithiane-d2	Inhibitor
  1,3-Dithiane-d2 is the deuterium labeled 1,3-Dithiane (HY-W001189). 1,3-Dithiane is a protected formaldehyde anion equivalent that could serve as a useful labeled synthon[1]. 1,3-Dithiane is also a sulfur-containing Maillard reaction products (MRPs) found in boiled beef extracts. 1,3-Dithiane shows a potent direct-acting mutagenicity toward S. typhimurium TA98 and TA100[2].

• HY-18219R

  Walrycin B (Standard)	Inhibitor

• HY-N11874

  Staphyloferrin A	Inhibitor
  Staphyloferrin A is a siderophore protein that can be combined with antibiotics to study drug-resistant bacteria that cause skin diseases[1].

• HY-N0610S

  trans-Cinnamic acid-d5
  trans-Cinnamic acid-d5 is the deuterium labeled trans-Cinnamic acid[1]. trans-Cinnamic acid is a natural antimicrobial, with minimal inhibitory concentration (MIC) of 250 μg/mL against fish pathogen A. sobria, SY-AS1[2].

• HY-14397A

  Indomethacin sodium hydrate
  Indomethacin (Indometacin) sodium hydrateis a potent, orally active COX1/2 inhibitor with IC50 values of 18 nM and 26 nM for COX-1 and COX-2, respectively. Indomethacin sodium hydrateis has anticancer activity and anti-infective activity. Indomethacin sodium hydrateis can be used for cancer, inflammation and viral infection research[1][2][3].

• HY-B0519R

  Tylosin (tartrate) (Standard)	Inhibitor
  Tylosin (tartrate) (Standard) is the analytical standard of Tylosin (tartrate). This product is intended for research and analytical applications. Tylosin tartrate is a macrolide antibiotic found naturally as a fermentation product of Streptomyces fradiae. Tylosin tartrate exerts potent antimicrobial activity against Gram-positive bacteria. Tylosin tartrate is widely used as a feed additive for promoting animal growth. Tylosin tartrate is used for veterinary purposes against bacterial dysentery and respiratory diseases in poultry, pigs and cattle[1][2][3].

• HY-B1389R

  Lactitol (monohydrate) (Standard)
  Lactitol (monohydrate) (Standard) is the analytical standard of Lactitol (monohydrate). This product is intended for research and analytical applications.

• HY-142031

  4-Piperidinecarboxamide	Inhibitor
  4-Piperidinecarboxamide is a mycobacterial aspartyl-tRNA synthetase (AspS) inhibitor. 4-Piperidinecarboxamide is a promising anti-tuberculosis (TB) agent[1].

• HY-B0295R

  Chloroxine (Standard)	Inhibitor
  Chloroxine (Standard) is the analytical standard of Chloroxine. This product is intended for research and analytical applications. Chloroxine is one of the important 8-hydroxyquinoline derivative. Chloroxine has effective antibacterial, antifungal, antiprotozoal and antiamoebic activities, especially used in treating the intestinal amebiasis. Chloroxine is also used in the treatment of dandruff and seborrheic dermatitis of the scalp[1][2].

• HY-N13906

  Alliacol B	Inhibitor
  Alliacol B is an antibiotic shows weak antibacterial and antifungal activity. Alliacol B inhibits DNA synthesis in cells of the ascitic form of Ehrlich carcinoma[1].

• HY-B0875B

  Cefmenoxime sodium	Inhibitor
  Cefmenoxime sodium is a new semisynthetic cephalosporin antibiotic. Cefmenoxime sodium has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria[1][2].

• HY-108062A

  BLI-489 hydrate	Inhibitor
  BLI-489 hydrate, a penem β-lactamase inhibitor, is active against class A and class C as well as some class D β-lactamases. The combination of Piperacillin and BLI-489 hydrate is efficacious against murine infections caused by class A (including extended-spectrum β-lactamases), class C (AmpC), and class D β-lactamase-expressing pathogens[1][2].

• HY-N10774

  Viroxocin
  Viroxocin is a diterpenoid. Viroxocin can be isolated from the roots of Salvia viridis L. cvar. Blue Jeans. Viroxocin also has weak antibacterial activity[1].

• HY-N3296

  Meridinol	Inhibitor
  Meridinol ((-)-Meridinol) shows antimicrobial activity against a wide range of gram-positive and gram-negative bacteria and fungi.

• HY-122307

  Sulisatin	Inhibitor
  Sulisatin (DAN-603) is an anionic laxative that is hydrolyzed to diphenolic derivatives by bacterial aryl sulfate sulfohydrolases in the colon during oral administration[1].

• HY-A0166S

  Cilastatin-15N,d3	Inhibitor	99.71%
  Cilastatin-15N,d3 is a 15N-labeled and deuterium labeled Cilastatin. Cilastatin (MK0791) is a reversible, competitive renal dehydropeptidase I inhibitor with an IC50 of 0.1 μM. Cilastatin inhibits the bacterial metallob-lactamase enzyme CphA with an IC50 of 178 μM. Cilastatin is an antibacterial adjunct[1][2][3].

• HY-P5563

  PP113	Inhibitor
  PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive bacteria, E.coli (MIC: 73.3 uM), B. subtilis (MIC: 23.3 uM), S. aureus (MIC: 13 uM), S. lutea (MIC: 16.7 uM), and B. pumilu (MIC: 23.3 uM)[1].

• HY-111086

  DG70	Inhibitor	99.91%
  DG70 (GSK1733953A), a biphenyl amide, is a respiration inhibitor in Mycobacterium tuberculosis, inhibits MenG activity with an IC50 value of 2.6 ± 0.6 μM. DG70 inhibits the catalytic methylation of Mycobacterium tuberculosis demethylmenaquinone methyltransferase enzymes. DG70 can be used for Tuberculosis (TB) research[1][2][3].

• HY-N0571R

  Purpurin (Standard)	Inhibitor
  Purpurin (Standard) is the analytical standard of Purpurin. This product is intended for research and analytical applications. Purpurin is a natural anthraquinone compound from Rubia cordifolia L.. Purpurin has antidepressant-like effects[1].

• HY-121362

  Evernic Acid	Inhibitor	99.71%
  Evernic Acid is a secondary metabolite generated by lichens, including Ramalina, Evernia, and Hypogymnia, and several studies have described its anticancer, antifungal, and antimicrobial effects. Neuroprotective and anti-inflammatory effects[1].

• HY-148831

  Antibacterial agent 135	Inhibitor
  Antibacterial agent 135 (example 7) is a potent antibacterial agent. Antibacterial agent 135 can inhibit P. aeruginosa, A. baumannii, E. coli, and K. pneumoniae, with MIC>64 μg/mL[1].

• HY-B1703R

  Nifursol (Standard)	Inhibitor
  3,5,6-tri-O-Benzyl-1,2-O-isopropylidene-D-glucofuranose (Standard) is the analytical standard of 3,5,6-tri-O-Benzyl-1,2-O-isopropylidene-D-glucofuranose. This product is intended for research and analytical applications. 3,5,6-tri-O-Benzyl-1,2-O-isopropylidene-D-glucofuranose (1,2-O-Isopropylidene-3,5,6-tri-o-benzyl-α-D-glucofuranose) is a synthetic sugar compound.

• HY-N12877

  Ophiobolin H	Inhibitor
  Ophiobolin H is a fungal metabolite that can be isolated from Aspergillus ustus. Ophiobolin H inhibits growth of Bacillus subtilis cultures. Ophiobolin H induces hyperacusia in day-old chicks at rates up to 375 mg/kg[1].

• HY-149226

  FtsZ-IN-8	Inhibitor
  FtsZ-IN-8 is a potent FtsZ inhibitor, to promote FtsZ polymerization and inhibit GTPase activity of FtsZ. Thus, FtsZ-IN-8 inhibits bacterial division to lead to death of bacterial cells. FtsZ-IN-8 shows bactericidal activity with no significant tendency to trigger bacterial resistance as well as rapid bactericidal properties. And FtsZ-IN-8 shows low hemolytic activity and cytotoxicity to mammalian cells[1].

• HY-143452

  MtTMPK-IN-4	Inhibitor
  MtTMPK-IN-4 (compound 2), a para-piperidine, is a potent mycobacterium tuberculosis thymidylate kinase (MtTMPK) inhibitor with an IC50 of 6.1 μM. MtTMPK-IN-4 is a potent tyrosinase inhibitor. MtTMPK-IN-4 is a potent antibacterial agent[1][2].

• HY-17593

  Solithromycin	Inhibitor	99.85%
  Solithromycin (CEM-101) is an orally bioavailable, effective antimicrobial agent, with IC50s for inhibition of cell viability, protein synthesis, and growth rate are 7.5 ng/mL, 40 ng/mL, and 125 ng/mL for Streptococcus pneumonia, Staphylococcus aureus, and Haemophilus influenzae, respectively. Solithromycin binds to the large 50S subunit of the ribosome and inhibits protein biosynthesis[1].

• HY-168873

  Anti-MRSA agent 23	Inhibitor
  Anti-MRSA agent 23 (compound 11) is a potent anti-methicillin-resistant Staphylococcus aureus agent. Anti-MRSA agent 23 shows antibacterial and antibiofilm activities. Anti-MRSA agent 23 accelerates the reconstruction and healing of MRSA-infected cutaneous wounds by decreasing bacterial loads, attenuating inflammation, and promoting angiogenesis[1].

• HY-126463

  LolCDE-IN-4	Inhibitor
  LolCDE-IN-4 (Compound 1) is exhibits antibacterial efficacy against gram negative bacteria Escherichia coli (MIC of 0.25-32 µg/ml) and Haemophilus influenzae, through inhibition LolCDE complex and disruption of lipoproteins release from the inner membrane[1].

• HY-B1336

  Furazolidone	Inhibitor
  Furazolidone is a nitrofuran derivative with antiprotozoal and antibacterial activity. It inhibits AML1-ETO transformed cells with an IC50 of 12.7 μM.

• HY-B2223

  Thiamine nitrate		99.41%
  Thiamine nitrate is an essential vitamin which can enhance normal neuronal actives.

• HY-N7101R

  Cefpodoxime Proxetil (Standard)	Inhibitor
  Cefpodoxime Proxetil (Standard) is the analytical standard of Cefpodoxime Proxetil. This product is intended for research and analytical applications. Cefpodoxime proxetil is an orally administered broad spectrum third-generation cephalosporin. Cefpodoxime proxetil has anti-bacterial activity. Cefpodoxime proxetil binds to penicillin binding proteins (PBPs) which inhibits peptidoglycan synthesis, finally results in interfering bacterial cell wall biosynthesis[1][2].

• HY-149581

  DprE1-IN-9	Inhibitor
  DprE1-IN-9 (compound B18) is an effective reversible DprE1 inhibitor and can bind to the receptor cavity of DprE1. DprE1-IN-9 shows strong antimycobacterial activity not only against non-pathogenic strain H37Ra (MIC=0.18 µg/mL) but also against pathogenic H37Rv and the clinical MDR and XDR isolates[1].

• HY-B0712AR

  Ceftriaxone (sodium hydrate) (Standard)	Inhibitor
  Ceftriaxone (sodium hydrate) (Standard) is the analytical standard of Ceftriaxone (sodium hydrate). This product is intended for research and analytical applications. Ceftriaxone sodium hydrate (Ro 13-9904 sodium hydrate) is a broad spectrum β-lactam third-generation cephalosporin antibiotic, which has good antibacterial activity against a variety of gram-negative and positive bacteria. Ceftriaxone sodium hydrate is a covalent inhibitor of GSK3β with IC50 value of 0.78 μM. Ceftriaxone sodium hydrate is an inhibitor of Aurora B. Ceftriaxone sodium hydrate has anti-inflammatory, antitumor and antioxidant activities. Ceftriaxone sodium hydrate can be used in the study of bacterial infections and meningitis[1][2][3][4][5][6][7].

• HY-A0214

  Colistin methanesulfonate sodium salt	Inhibitor
  Colistin methanesulfonate sodium salt exhibits MIC values ranged from 4 to 16 mg/liter against susceptible strains (P. aeruginosa)[1].

• HY-120733

  Calpinactam	Inhibitor
  Calpinactam (FKI-4905), a fungal metabolite, is a new anti-mycobacterial agent.Calpinactam is active only against Mycobacteria among various microorganisms, including Gram-positive and Gram-negative bacteria, fungi and yeasts. Calpinactam inhibits the growth of Mycobacterium smegmatis and Mycobacterium tuberculosis with MIC values of 0.78 and 12.5 μg/ml, respectively[1].

• HY-N7921

  Urolithin M6	Inhibitor
  Urolithin M6 is a polyhydroxy-rich metabolite with potential antioxidant activity. Urolithin M6 is produced by intestinal microbial metabolism and may act as an analog of tannic acid compounds. The production of Urolithin M6 in humans requires specific bacterial 3-dehydroxylase activity, which provides a new mechanism for its biotransformation. The metabolic profile of Urolithin M6 helps to stratify volunteers and further explore its potential role in health and disease[1].

• HY-112586

  Sulfaethoxypyridazine	Inhibitor
  Sulfaethoxypyridazine is a sulfonamide antibacterial agent. Sulfaethoxypyridazine is a sulfonamide that is used in veterinary medicine as feedstuffs[1].

• HY-N0571

  Purpurin	Inhibitor
  Purpurin is a natural anthraquinone compound from Rubia cordifolia L.. Purpurin has antidepressant-like effects[1].

• HY-119881R

  Alafosfalin (Standard)	Inhibitor
  Methyl behenate (Standard) is the analytical standard of Methyl behenate. This product is intended for research and analytical applications. Methyl behenate (Methyl docosanoate) is a naturally fatty acid methyl ester isolated from the plant of Aspidopterys obcordata Lemsl[1].

• HY-W103170

  1,8-Dichloroanthraquinone
  1,8-Dichloroanthraquinone, an anthraquinone, is an inhibitor of sulfide production by sulfate-reducing bacteria[1].

• HY-135498

  Ferrioxamine E	Inhibitor
  Ferrioxamine E is a bacterial siderophore produced by a variety of bacteria including S. glaucescens, M. luteus, and P. mendocina. Ferrioxamines, including ferrioxamine E, are the sole iron source for Salmonella, and have been used as growth enriching agents in the detection of Salmonella in food and industrial applications.

• HY-Y0403R

  3-Chlorobenzoic acid (Standard)
  3-Chlorobenzoic acid (Standard) is the analytical standard of 3-Chlorobenzoic acid. This product is intended for research and analytical applications. 3-Chlorobenzoic acid (m-Chlorobenzoic acid) is the only carbon source for the bacterium[1].

• HY-172132

  MurA-IN-5	Inhibitor
  MurA-IN-5 (compound 4c) exhibits (MIC) = 1.95 μg/mL against Escherichia coli and demonstrating significant potency as a MurA inhibitor with (IC50) of 3.77 μg/mL. MurA-IN-5 displays an antibiofilm activity against multiple microorganisms, indicating its potential to combat biofilm-related infections[1].

• HY-161998

  Urease-IN-16	Inhibitor
  Urease-IN-16? (compound 4e)? is a urease inhibitor, with an IC50 value of 132 μmol/L. Urease-IN-16 can coordinate with the nickel atom through the oxygen atoms of carbonyl or boronic acid groups. Urease-IN-16 shows great potential as an additive in the development of efficient fertilizers and medical applications[1].

• HY-N2169

  Polygalasaponin V		99.94%
  Polygalasaponin V is a triterpenoid saponin isolated from the aerial parts of Polygala japonica. Polygala japonica has been a folk medicine herb used as expectorant, anti-inflammatory, antibacterial and antidepressant agents in the south of China[1].

• HY-B1143

  Broxaldine	Inhibitor	99.50%
  Broxaldine (Brobenzoxaldine) is an antiprotozoal agent. Broxaldine inhibits Clostridium difficile with a MIC value of 4 µM, and has antifungal effects[1][2].

• HY-112657

  Xanthorrhizol	Inhibitor	98.46%
  Xanthorrhizol, isolated from Curcuma xanthorrhiza Roxb, is a potential antibacterial agent.

• HY-144664

  MtTMPK-IN-2	Inhibitor
  MtTMPK-IN-2 (compound 15) is a potent Mycobacterium tuberculosis thymidylate kinase (MtTMPK) inhibitor with an IC50 value of 1.1 μM. MtTMPK-IN-2 has inhibitory activity against Mtb H37Rv (MIC = 12.5 μM). MtTMPK-IN-2 exhibits certain cytotoxicity in human fibroblast cells MRC-5 (EC50 = 6.1 μM). MtTMPK-IN-2 can be used for researching tuberculosis[1].

• HY-N5127

  Nonacosane	Inhibitor
  Nonacosane, isolated from Baphia massaiensis, exhibits weak activities against E. coli, B. subtilis, P. aeruginosa and S. aureus[1].

• HY-19285A

  Sulfaclozine sodium	Inhibitor	99.02%
  Sulfaclozine sodium (Sulfachloropyrazine sodium) is an efficacious sulphonamide derivative with antibacterial and anticoccidial effects. Sulfaclozine sodium is commonly used for the treatment of various poultry diseases (particularly, collibacteriosis, fowl cholera and coccidiosis)[1].

• HY-N1103AR

  Vasicine (hydrochloride) (Standard)	Inhibitor
  Vasicine (hydrochloride) (Standard) is the analytical standard of Vasicine (hydrochloride). This product is intended for research and analytical applications. Vasicine hydrochloride (peganine hydrochloride) is a quinazoline alkaloid isolated from Justicia adhatoda. Vasicine (peganine) possesses anti- tuberculosis activity[1].

• HY-126629

  Antibacterial agent 12	Inhibitor
  Antibacterial agent 12, a biaryloxazolidinone analogue, is an antibacterial agent against antibiotic-susceptible and antibiotic-resistant Gram-positive bacteria[1].

• HY-B1267R

  Sulfaguanidine (Standard)	Inhibitor
  Sulfaguanidine (Standard) is the analytical standard of Sulfaguanidine. This product is intended for research and analytical applications. Sulfaguanidine is an orally active antimicrobial agent/antibiotic of sulfonamide class. Sulfaguanidine can be used for the research of enteric infections such as bacillary dysentery[1][2].

• HY-P2442

  Bombolitin V
  Bombolitin V is a potent antimicrobial peptide with an ED50 value of 2 micrograms/ml in causing mast cell degranulation[1].

• HY-15662R

  Tulathromycin A (Standard)	Inhibitor
  Tulathromycin A (Standard) is the analytical standard of Tulathromycin A. This product is intended for research and analytical applications. Tulathromycin A (Tulathromycin), a macrolide antibiotic, inhibits protein synthesis (IC50=0.26 μM) by targeting bacterial ribosome. Tulathromycin A is used for the research of respiratory disease in cattle and swine. Immunomodulatory effects[1][2][3].

• HY-B1267S

  Sulfaguanidine-d4	Inhibitor
  Sulfaguanidine-d4 is the deuterium labeled Sulfaguanidine. Sulfaguanidine, belongs to the class of sulfonamide agent, is an orally active antibiotic. Sulfaguanidine can be used for the research of enteric infections such as bacillary dysentery[1][2].

• HY-W004294S1

  1-Tetradecanol-d2
  1-Tetradecanol-d2 is the deuterium labeled 1-Tetradecanol[1]. 1-Tetradecanol, isolated from Myristica fragrans, is a straight-chain saturated fatty alcohol. 1-Tetradecanol possesses antibacterial and anti-inflammatory (periodontitis) activity[2].

• HY-N13186

  δ-(E)-Deoxy-amplexichromanol	Inhibitor
  δ-(E)-Deoxy-amplexichromanol is a δ-tocotrienolic acid derivative with potent antibacterial activities, which is derivated from hydromethanolic extract of the cones of C. atlantica[1].

• HY-141648

  Antibacterial agent 219	Inhibitor
  Antibacterial agent 219 (Compound 2/75c) exhibits antibacterial activity by targeting cell wall biosynthesis. Antibacterial agent 219 inhibits methicillin-resistant Staphylococcus aureus (MRSA) strains (MIC=0.5-32 µg/mL), Enterococcus faecium (MIC=2 µg/mL) and S. aureus (MIC=2 µg/mL)[1][2].

• HY-120859A

  Zidebactam sodium salt	Inhibitor
  Zidebactam sodium salt (WCK-5107 sodium salt) is a potent β-lactamase inhibitor[1]. Zidebactam also is a penicillin-binding protein2 (PBP2) inhibitor with an IC50 of 0.26 μg/mL[2].

• HY-B2170

  Octenidine	Inhibitor
  Octenidine is a potent antibacterial agent, possessing activity against multidrug-resistant Gram-negative pathogens. Octenidine can inhibit the expression of biofilm genes and destroy the formation of biofilms[1][3].

• HY-163984

  Antibacterial agent 240	Inhibitor
  Antibacterial agent 240 (compound 62-7c) is an antibacterial agent that can target multidrug-resistant (MDR) MRSA strains. Antibacterial agent 240 showed high biosafety and potent anti-infection activity in mouse pneumonia and mouse wound models of MRSA infection[1].

• HY-P5606

  Maximin 3	Inhibitor
  Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 3 has cytotoxicity on tumor cells and spermicidal effect. Maximin 3 has significant anti-HIV activity[1].

• HY-153722A

  Dodicin hydrochloride	Inhibitor
  Dodicin hydrochloride is an effective disinfectant with broad antimicrobial activity[1].

• HY-N10133

  Licoflavanone	Inhibitor
  Licoflavanone (compopund 2) is a flavanone. Licoflavanone can be isolated from the MeOH extract of Air-dried leaves of G. glabra var. typica. Licoflavanone has antibacterial activity[1].

• HY-N0017

  Bergenin	Inhibitor	99.21%
  Bergenin is a cytoprotective and antioxidative polyphenol found in many medicinal plants. Bergenin has a wide spectrum activities such as hepatoprotective, antiinflammatory, immunomodulatory, antitumor, antiviral, and antifungal properties[1][2].

• HY-B0006A

  Carvedilol phosphate hemihydrate		99.94%
  Carvedilol phosphate hemihydrate (BM 14190 phosphate hemihydrate) is a non-selective β/α-1 blocker[1]. Carvedilol phosphate hemihydrate inhibits lipid peroxidation with an IC50 of 5 μM. Carvedilol phosphate hemihydrate is a multiple action antihypertensive agent with potential use in angina and congestive heart failure[2]. Carvedilol phosphate hemihydrate is an autophagy inducer that inhibits the NLRP3 inflammasome[3].

• HY-W268942

  4-Nitrosodiphenylamine	Inhibitor
  4-Nitrosodiphenylamine shows great antibacterial activity against Erwinia amylovora, with an EC50 value of 5.715 mg/L[1].

• HY-N7516

  4'-Hydroxy-2,4-dimethoxychalcone	Inhibitor	99.76%
  4'-Hydroxy-2,4-dimethoxychalcone is a natural chalcone derivatives in the red herbal resin of Dracaena cochinchinensis. 4'-Hydroxy-2,4-dimethoxychalcone displays a wide range of biological activities including antimalarial, antiprotozoal, antibacterial, antifungal activity[1][2].

• HY-N7139

  Penicillin G
  Penicillin G is a potent penicillinantibiotic. Penicillin G can be used for bacterial infection. Penicillin G has potent activity against all Gram-positive bacteria and Gram-negative cocci[1][2].

• HY-N8337

  IT-143B	Inhibitor
  IT-143B is an antibiotic, that exhibits antibacterial activity against Micrococcus luteus with MIC of 6.25μg/mL. IT-143B inhibits growth of cancer cell KB with an IC50 of 1.1 ng/mL[1].

• HY-N14170

  Ashimycin B	Inhibitor
  Ashimycin B is a Streptomycin (HY-B1906) analogue with a broad-spectrum antibacterial activity[1].

• HY-101967

  GSK299423	Inhibitor
  GSK 299423 is an antibiotic agent.GSK299423 shows potent inhibition of supercoiling by DNA gyrase from S. aureus(IC50=14 nM）and Escherichia coli(IC50=100 nM[1].

• HY-169697

  Thiocillin	Inhibitor
  Thiocillin is a thiopeptide class of RiPPs and anti-bacterial agent. Thiocillin targets the bacterial 50S ribosome. Thiocillin exhibits potent antibacterial activity against a number of agent resistant pathogens[1].

• HY-P10618

  BTM-P1	Inhibitor
  BTM-P1 is a polycationic peptide that exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. BTM-P1 can form ion-permeable channels in the inner mitochondrial membrane to interfere with mitochondrial energy processes[1].

• HY-17452A

  Cefditoren Pivoxil	Inhibitor	99.29%
  Cefditoren Pivoxil (ME 1207) is a broad-spectrum, third-generation, oral cephalosporin antibacterial with enhanced stability against many common β lactamases. Cefditoren Pivoxil has activity against Gram-negative organisms and Gram-positive organisms. Cefditoren Pivoxil can be used in the research of infection diseases such as acute exacerbations of chronic bronchitis, community-acquired pneumonia (CAP), streptococcal pharyngitis/tonsillitis, or uncomplicated skin and skin structure infections[1][2].

• HY-B1241R

  Dihydrostreptomycin (sulfate) (Standard)	Inhibitor
  Dihydrostreptomycin (sulfate) (Standard) is the analytical standard of Dihydrostreptomycin (sulfate). This product is intended for research and analytical applications.

• HY-N12232

  Carbazomycin D	Inhibitor
  Carbazomycin D exhibits antituberculosis and antimalarial activities, that inhibits Plasmodium falciparum with an IC50 > 10 μg/mL, inhibits Mycobacterium tuberculosis with MIC of 25 μg/mL. Carbazomycin D exhibits cytotoxicity in cell MCF-7, KB, NCI-H187 and Vero, with IC50s of 21.3, 33.2, 12.9, and 34.3 μg/mL, respectively[1].

• HY-168004

  FolB-IN-1	Inhibitor
  FolB-IN-1 (Compound 3e) is an inhibitor of FolB that can suppress the activity of FolB enzyme from Mycobacterium tuberculosis (MtFolB). FolB-IN-1 exhibits antimycobacterial activity with an MIC value of 40 µg/mL (108 µM)[1].

• HY-123914

  P516-0475	Inhibitor
  P516-0475 is an uncompetitive inhibitor against endopeptidase PepO. P516-0475 is also an agonist of the Rgg2/3 system with antibacterial activity. P516-0475 induces expression of Rgg2/3-regulated genes in the presence of short hydrophobic pheromone (SHP) for activity and leads to positive modulation of lysozyme resistance[1][2].

• HY-B1290S1

  2-Phenylethanol-d9
  2-Phenylethanol-d9 is the deuterium labeled 2-Phenylethanol[1]. 2-Phenylethanol (Phenethyl alcohol), extracted from rose, carnation, hyacinth, Aleppo pine, orange blossom and other organisms, is a colourless liquid. It has a pleasant floral odor and also an autoantibiotic produced by the fungus Candida albicans[2]. It is used as an additive in cigarettes and also used as a preservative in soaps due to its stability in basic conditions.

• HY-B0573R

  Propranolol (hydrochloride) (Standard)
  Propranolol (hydrochloride) (Standard) is the analytical standard of Propranolol (hydrochloride). This product is intended for research and analytical applications. Propranolol hydrochloride is a nonselective β-adrenergic receptor (βAR) antagonist, has high affinity for the β1AR and β2AR with Ki values of 1.8 nM and 0.8 nM, respectively[1]. Propranolol hydrochloride inhibits [3H]-DHA binding to rat brain membrane preparation with an IC50 of 12 nM[2]. Propranolol hydrochloride is used for study of hypertension, pheochromocytoma, myocardial infarction, cardiac arrhythmias, angina pectoris, and hypertrophic cardiomyopathy[3].

• HY-W087943

  Methyl octanoate	Inhibitor	99.55%
  Methyl octanoate, a volatile compound, is an aroma component persimmon wine[1].

• HY-P2329

  Lysostaphin	Inhibitor
  Lysostaphin is an antistaphylococcal agent. Lysostaphin has activities of three enzymes namely, glycylglycine endopeptidase, endo-β-N-acetyl glucosamidase and N-acteyl muramyl-L-alanine amidase[1].

• HY-151165

  LasR-IN-3	Inhibitor	99.57%
  LasR-IN-3 is a LasR inhibitor against Pseudomonas aeruginosa. LasR-IN-3 induces LasR structure instability and completely dissociates LasR functioning dimeric form[1].

• HY-W042181R

  N-Decyl-N,N-dimethyldecan-1-aminium (chloride) (Standard)	Inhibitor
  N-Decyl-N,N-dimethyldecan-1-aminium (chloride) (Standard) is the analytical standard of N-Decyl-N,N-dimethyldecan-1-aminium (chloride). This product is intended for research and analytical applications. N-Decyl-N,N-dimethyldecan-1-aminium chloride (Didecyldimethylammonium chloride) is a dialkyl-quaternary ammonium compound that is used in numerous products for its bactericidal, virucidal and fungicidal properties[1].

• HY-150044

  Type II topoisomerase inhibitor 1	Inhibitor
  Type II topoisomerase inhibitor 1 is a potent and selective E. coli DNA gyrase inhibitor (IC50: 1.7 nM), and forms hydrogen bonds with Asp73 residue. Type II topoisomerase inhibitor 1 inhibits topoisomerase IV activity (IC50: 0.98 μM). Type II topoisomerase inhibitor 1 can be used in the research of antibacterial area[1][2].

• HY-17029R

  Epothilone B (Standard)

• HY-N10473

  Pulcherriminic acid	Inhibitor
  Pulcherriminic acid is a cyclic dipeptide antimicrobial agent with high affinity for Fe3+, found mainly in Bacillus and yeast. Pulcherriminic acid chelates iron ions through a non-enzymatic reaction to form the extracellular red pigment pulcherrimin, which competes for iron nutrition and thus achieves an antibacterial effect. Pulcherriminic acid has great applications in food, agriculture and medical industries[1][2].

• HY-N2061

  Lindenenol	Inhibitor	99.85%
  Lindenenol is isolated from Radix linderae, with antioxidant and antibacterial activities[1].

• HY-130079

  Procaine benzylpenicillin	Inhibitor
  Procaine benzylpenicillin (Penicillin G procaine) is an antimicrobial agent. Procaine benzylpenicillin shows inhibitory activity against gram-positive bacteria and synergistic activity with Neomycin (HY-B0470). Procaine benzylpenicillin can be used in the study of bovine mastitis in animal husbandry[1].

• HY-139835

  Antistaphylococcal agent 2	Inhibitor
  Antistaphylococcal agent 2 is an antistaphylococcal therapeutic agent.

• HY-146158

  Fudapirine	Inhibitor
  Fudapirine, an anti-tuberculosis agent, displays excellent anti-mycobacterial activity against M. tuberculosis H37Rv and low cytotoxicity. Fudapirine exhibits potent activity with MIC50s of 0.083 and 0.11 μg/mL for agent susceptible tuberculosis (DS-TB) and multidrug resistant tuberculosis (MDR-TB) strains. Fudapirine also inhibits hERG channel with the IC50 of 1.89 μM.

• HY-N8439

  Questiomycin A	Inhibitor	98.20%
  Questiomycin A (Phx-3) is a GRP78 (cytoprotective endoplasmic reticulum chaperone) degrader and enhances the anticancer activity of Sorafenib. Questiomycin A is also an antimicrobial/antibiotic that can be obtained from the metabolite of Pseudomonas chlororaphis HT66. Questiomycin A can be used in research on biological control of cancer and plant diseases[1][2].

• HY-10979

  AN0128	Inhibitor	98.04%
  AN0128 is a boron-containing antibacterial and anti-inflammatory agent. AN0128 against S. aureus, S. epidermidis, P. acnes, B. subtilis with minimum inhibitory concentration (MIC) values of 1, 0.5, 0.3, 1 μg/mL. AN0128 can be used for the research of periodontal disease and cutaneous diseases[1][2].

• HY-B1005R

  8-Hydroxyquinoline (Standard)	Inhibitor
  8-Hydroxyquinoline (Standard) is the analytical standard of 8-Hydroxyquinoline. This product is intended for research and analytical applications. 8-Hydroxyquinoline (8-Quinolinol) is a lipophilic metal chelator that can be used as a fungicide .8-Hydroxyquinoline shows the MIC range of 27.56-55.11 μM (4-8 μg/mL) against the clinical isolates of Neisseria gonorrhoeae. 8-Hydroxyquinoline can bind to copper form complexes and transport copper into cells. 8-Hydroxyquinoline increases in the number of micronucleated polychromatic erythrocytes and can also make hair depigmented in mice[1][2][3][4][5].

• HY-B1784

  Sulfisomidin	Inhibitor	99.75%
  Sulfisomidin (Sulfaisodimidine) is an orally active short-acting sulfonamide antibacterial. Sulfisomidin can be used for the research of lower urinary tract infections[1][2].

• HY-N4003

  Isobonducellin	Inhibitor
  Isobonducellin is a flavonoid product and shows antimicrobial activity[1].

• HY-N0232R

  Psoralidin (Standard)	Inhibitor
  Psoralidin (Standard) is the analytical standard of Psoralidin. This product is intended for research and analytical applications. Psoralidin is a dual inhibitor of COX-2 and 5-LOX, regulates ionizing radiation (IR)-induced pulmonary inflammation.Anti-cancer, anti-bacterial, and anti-inflammatory properties[1]. Psoralidin significantly downregulates NOTCH1 signaling. Psoralidin also greatly induces ROS generation[2].

• HY-13678A

  Meropenem trihydrate	Inhibitor
  Meropenem trihydrate (SM 7338 trihydrate) is a carbapenem antibiotic with broad-spectrum antibacterial activity. Meropenem trihydrate has activity against susceptible and resistant N. gonorrhoeae (MIC value of 0.02-0.06 mg/mL), H. influenzae (MIC value of 0.03-0.12 mg/mL), and H. ducreyi (MIC value of 0.015-0.12 mg/mL)[1][2].

• HY-144284

  MsbA-IN-5	Inhibitor
  MsbA-IN-5 (compound 40) is a potent and highly selective MsbA inhibitor with an IC50 value of 2 nM. MsbA-IN-5 has inhibitory activity against Escherichia coli, Klebsiella pneumoniae, and Enterobacter cloacae with MICs of 12 μM, 12 μM and 25 μM, respectively. MsbA-IN-5 can be used for researching anti-Gram-negative bacteria[1].

• HY-N0108

  Physcion	Inhibitor
  Physcion (Parietin), an anthraquinone derivative derived from the traditional Chinese medicine rhubarb, is an effective oral active 6-phosphogluconate dehydrogenase inhibitor with blood-brain barrier permeability, with IC50 and Kd values of 38.5 μM and 26.0 μM, respectively. Additionally, Physcion is an inhibitor of the <>bTLR4/NF-κB signaling pathway, exhibiting anti-inflammatory, antibacterial, and anticancer effects, and can induce Apoptosis and Autophagy in cancer cells[1][2][3][4][5].

• HY-B0425A

  Novobiocin sodium	Inhibitor
  Novobiocin (Albamycin) sodium is a potent and orally active antibiotic. Novobiocin sodium also is a DNA gyrase inhibitor and a heat shock protein 90 (Hsp90) antagonist. Novobiocin sodium has the potential for the research of highly beta-lactam-resistant pneumococcal infections. Novobiocin sodium shows anti-orthopoxvirus activity[1][2][3][4].

• HY-16911R

  AFN-1252 (Standard)	Inhibitor
  Apramycin (Standard) is the analytical standard of Apramycin. This product is intended for research and analytical applications. 0

• HY-B0458A

  Cefprozil	Inhibitor
  Cefprozil (Cefzil) is a second-generation cephalosporin type antibiotic[1].

• HY-119789

  Albofungin	Inhibitor
  Albofungin (Antibiotic P-42-1) is isolated from the culture filtrate of Actinomyces tumemacerans strain INMI.P-42. Albofungin shows highly active on a wide variety of gram-positive bacteria and fungi. Albofungin shows cytotoxic to HeLa cell cultures and exhibited antitumor activity on EHRLICH ascites tumor in mice.

• HY-P2324

  Gramicidin A	Inhibitor
  Gramicidin A is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Gramicidin A is a highly hydrophobic channel-forming ionophore that forms channels in model membranes that are permeable to monovalent cations. Gramicidin A induces degradation of hypoxia inducible factor 1 α (HIF-1α)[1][2].

• HY-150967

  MmpL3-IN-1	Inhibitor
  MmpL3-IN-1 (compound 32) is a potent Mycobacterial membrane protein large 3 (MmpL3) inhibitor. MmpL3-IN-1 has anti-tuberculosis activity with the MIC<0.016 μg/mL in M. tuberculosis and can be used in studies of drug-resistant tuberculosis[1].

• HY-P1513A

  LL-37 scrambled peptide acetate		99.79%
  LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.

• HY-130049

  Lucidin ω-ethyl ether	Inhibitor
  Lucidin ω-ethyl ether (compound 17) is an anthraquinone metabolite isolated from the root part of Prismatomeris filamentosa with some antibacterial activity against Gram-positive and Gram-negative bacteria[1].

• HY-13832R

  Atovaquone (Standard)
  Atovaquone (Standard) is the analytical standard of Atovaquone. This product is intended for research and analytical applications. Atovaquone (Atavaquone) is a potent, selective and orally active inhibitor of the parasite’s mitochondrial cytochrome bc1 complex. Atovaquone is against human and  P. falciparum cytochrome bc1 activity with IC50 values of 460 nM and 2.0 nM, respectively. Atovaquone is an antimalarial agent and has the potential for the investigation of neumocystis pneumonia, toxoplasmosis, malaria, and babesia[1][2].

• HY-W290527

  2-Isopropyl-5-methylanisole	Inhibitor
  2-Isopropyl-5-methylanisole is an inhibitor of Mycobacterium tuberculosis chorismate mutase (CM) with an IC50 of 21.58 μM. The MIC of 2-Isopropyl-5-methylanisole for Mycobacterium tuberculosis is 152.22 µM. 2-Isopropyl-5-methylanisole holds potential for research in the field of anti-infective studies[1].

• HY-N2192

  Swertianolin	Inhibitor
  Swertianolin, a xanthone isolated from Gentianella Acuta, inhibits acetylcholinesterase (AChE). Swertianolin also exhibits anti-HBV and anti-bacterial activity[1][2].

• HY-17425AR

  Valacyclovir (hydrochloride) (Standard)
  Valacyclovir (hydrochloride) (Standard) is the analytical standard of Valacyclovir (hydrochloride). This product is intended for research and analytical applications. Valacyclovir hydrochloride (Valaciclovir hydrochloride) is an orally active antiviral agent for herpes simplex, herpes zoster, and herpes B. Valacyclovir hydrochloride inhibits HSV-1 W (50=2.9 μg/ml). Valacyclovir hydrochloride is a proagent of Aciclovir (HY-17422) [1][2][3][4][5].

• HY-17359R

  Deferasirox (Standard)	Inhibitor
  Deferasirox (Standard) is the analytical standard of Deferasirox. This product is intended for research and analytical applications. Deferasirox (ICL 670) is an orally available iron chelator used for the management of transfusional iron overload[1][2][3].

• HY-145605

  Vutiglabridin	Inhibitor	99.74%
  Vutiglabridin (HSG4112), a racemic compound, is a potent anti-obesity agent[1]. Vutiglabridin, an optimized structural analog of Glabridin, markedly supersedes Glabridin in weight reduction efficacy and chemical stability[1].

• HY-P10134

  Salivaricin B	Inhibitor
  Salivaricin B is a broad-spectrum bacteriocin produced by Lactobacillus salivarius M7, capable of inhibiting the growth of Listeria monocytogenes, Bacillus cereus, Brochothrix thermosphacta, Enterococcus faecalis, and various lactobacilli[1].

• HY-145416

  G247
  G247 is a specific MsbA inhibitor. G247 acts as a transmembrane domains (TMDs) wedge, symmetrically increasing nucleotide-binding domains (NBDs) separation and preventing conformational transition of MsbA. G247 suppresses ATPase activity by increasing inter-NBD distance[1].

• HY-W018025R

  5,6-Dihydroxyindole (Standard)	Inhibitor
  5,6-Dihydroxyindole (Standard) is the analytical standard of 5,6-Dihydroxyindole. This product is intended for research and analytical applications. 5,6-Dihydroxyindole, a melanin precursor, has a broad-spectrum antibacterial, antifungal, antiviral, antiparasitic activity. 5,6-Dihydroxyindole has cytotoxic effects and is strongly toxic against various pathogens[1].

• HY-B1743AS

  Puromycin-d3 dihydrochloride	Inhibitor
  Puromycin-d3 (dihydrochloride) is the deuterium labeled Puromycin dihydrochloride. Puromycin dihydrochloride (CL13900 dihydrochloride), an aminonucleoside antibiotic, inhibits protein synthesis[1].

• HY-E70221

  α-Acetolactate decarboxylase, from Bacillus subtilis
  α-Acetolactate decarboxylase, from Bacillus subtilis is an enzyme responsible for acetoin production, and can be widely used in food processing[1].

• HY-N0285S

  Imperatorin-d6	Inhibitor
  Imperatorin-d6 (Ammidin-d6) is the deuterium labeled Imperatorin. Imperatorin is a BChE inhibitor and HIV-1 replication inhibitor. Imperatorin shows mild activity against Gram-negative bacteria[1].

• HY-N7003

  28-Demethyl-β-amyrone	Inhibitor
  28-Demethyl-β-amyrone (28-Norolean-12-en-3-one) is one of the main triterpenes from Pistacia lentiscus var. Chia[1]. 28-Demethyl-β-amyrone is an antitoxin and can effectively for the toxic effects of Staphylococcal enterotoxins (SEs)[2].

• HY-N0930B

  Galegine hydrochloride	Inhibitor
  Galegine hydrochloride, a guanidine derivative, contributes to weight loss in mice. Guanidine hydrochloride is the compound derived from G. officinalis, which gave rise to the biguanides, metformin and phenformin. Galegine hydrochloride activates AMPK in 3T3-L1 adipocytes and L6 myotubes, as well as in the H4IIE rat hepatoma and HEK293 human kidney cell lines. Galegine hydrochloride has antibacterial activity, with minimum inhibitory concentration of 4 mg/L against Staphylococcus aureus strains[1][2].

• HY-13451R

  Finafloxacin (Standard)	Inhibitor
  Citric acid (Standard) is the analytical standard of Citric acid. This product is intended for research and analytical applications. Citric acid is a natural preservative and food tartness enhancer. Citric acid induces apoptosis and cell cycle arrest at G2/M phase and S phase in HaCaT cells. Citric acid cause oxidative damage of the liver by means of the decrease of antioxidative enzyme activities. Citric acid causes renal toxicity in mice[1][2][3].

• HY-107792

  Benurestat	Inhibitor
  Benurestat is an orally active urease inhibitor. Benurestat can be used for infected ureolysis research[1].

• HY-161395

  IDD-8E	Inhibitor
  IDD-8E is an effective anti-pseudomonal agent (MIC =4.4 µM ) with no cytotoxicity. IDD-8E shows significant pseudomonal killing and disruption of pseudomonal biofilm. IDD-8E binds to the ATP-binding pocket of WaaP and also inhibits other ESKAPE pathogens. [1]

• HY-B0930R

  Efloxate (Standard)	Inhibitor
  Efloxate (Standard) is the analytical standard of Efloxate. This product is intended for research and analytical applications. 0

• HY-144663

  MtTMPK-IN-1	Inhibitor
  MtTMPK-IN-1 (compound 3) is a potent Mycobacterium tuberculosis thymidylate kinase (MtTMPK) inhibitor with an IC50 value of 2.5 μM. MtTMPK-IN-1 has moderate to weak activity against Mtb H37Rv and low cytotoxicity in human fibroblast cells MRC-5. MtTMPK-IN-1 can be used for researching tuberculosis[1].

• HY-W010629

  2-Chloroacetamide	Inhibitor
  2-Chloroacetamide is a preservative and is a herbicide for both uplands and paddy fields. 2-Chloroacetamide is a biocide in agriculture, glues, paints and coatings. 2-Chloroacetamide inhibits very-long-chain fatty acid elongase[1][2][3].

• HY-N1937

  Pristimerin	Inhibitor	99.22%
  Pristimerin is a potent and reversible monoacylglycerol lipase (MGL) inhibitor with an IC50 of 93 nM.

• HY-146329R

  PqsR/LasR-IN-3 (Standard)	Inhibitor
  Ganoderic acid C2 (Standard) is the analytical standard of Ganoderic acid C2. This product is intended for research and analytical applications. Ganoderic acid C2 is a bioactive triterpenoid in Ganoderma lucidum. Ganoderic acid C2 possesses the potential anti-tumor bioactivity, antihistamine, anti-aging and cytotoxic effects. Ganoderic acid C2 exhibits high inhibitory activity against the rat lens aldose reductase (RLAR) with an IC50 of 3.8 µM[1][2].

• HY-W040129

  Chromomycin A3	Inhibitor
  Chromomycin A3 is an aureolic acid-type antitumor antibiotic. Chromomycin A3 forms dimeric complexes with divalent cations, such as Mg2+, which strongly binds to the GC rich sequence of DNA to inhibit DNA replication and transcription. Chromomycin A3 has a variety of utilities as a staining agent for human sperm chromatin, autophagy inducing agent, and apoptosis inhibitor[1].

• HY-107825

  Flavonol	Inhibitor
  Flavonol is a cholinesterase (ChE) inhibitor, with an IC50 value of 120 μM and a Ki value of 74 μM. Flavonol has antioxidant, free radical-scavenging, antibacterial properties, and immune modulation functions. Flavonol inhibits the PriA helicase of Staphylococcus aureus. Flavonol can suppress the production of NO in LPS-activated RAW 264.7 cells by inhibiting the expression of the iNOS enzyme. Flavonol shows protective and analgesic effects in mice through various neuronal pathways. Flavonol can be used in research related to tumors and atherosclerosis diseases[1][2][3][4].

• HY-I0501R

  2'-Aminoacetophenone (Standard)
  2'-Aminoacetophenone (Standard) is the analytical standard of 2'-Aminoacetophenone. This product is intended for research and analytical applications. 2'-Aminoacetophenone is an orally active inducer of apoptosis and respiratory biomarker. 2'-Aminoacetophenone can be used to detect Pseudomonas aeruginosa infections in the lungs of cystic fibrosis patients. 2'-Aminoacetophenone can inhibit the protein levels of LC3BII and p62 in macrophages infected with pqsA or mvfR and regulate autophagy. 2'-Aminoacetophenone can disrupt mitochondrial function by inducing oxidative stress and apoptosis signaling, leading to dysfunction in mouse skeletal muscle[1][2][4].

• HY-106597A

  Pirlimycin hydrochloride	Inhibitor
  Pirlimycin hydrochloride, a lincosamide antibiotic, is active against Gram-positive bacteria. Pirlimycin hydrochloride acts by inhibiting bacterial protein synthesis via binding with the 50S subunit of the ribosome[1].

• HY-167935

  LCC-12 formic	Inhibitor
  LCC-12 formic is a dimer of metformin that targets mitochondrial copper(II), leading to a decrease in the NAD(H) pool and modulation of inflammatory responses. LCC-12 formic reduces inflammation in mouse models of bacterial and viral infections. LCC-12 formic also serves as a tool for investigating metabolic diseases through its effects on cell plasticity and epigenetic programming.

• HY-B1190S

  Cefadroxil-d4 hydrate	Inhibitor
  Cefadroxil-d4 (hydrate) is the deuterium labeled Cefadroxil. Cefadroxil is a broad-spectrum antibiotic of the cephalosporin type, effective in Gram-positive and Gram-negative bacterial infections.

• HY-P1699

  Aurantimycin A	Inhibitor
  Aurantimycin A (Adipogen), a depsipeptide antibiotic, displays strong activity against Gram-positive bacteria. Aurantimycin A is a substrate of the LieAB transporter[1][2].

• HY-163030

  LasB-IN-1	Inhibitor
  LasB-IN-1 (compound 5f) is a potent and orally active inhibitor of LasB (IC50 = 8.7 μM). LasB-IN-1 effectively attenuates elastase production and biofilm formation by P. aeruginosa while alleviating the inflammatory response through downregulating MAPK and NF-κB pathways. LasB-IN-1 is potential to be a novel anti-infective candidate against drug-resistant infections[1].

• HY-W010611

  3-Methylbut-2-enoic acid	Inhibitor
  3-Methylbut-2-enoic acid is an active small molecule, that can be used as drug intermediate[1].

• HY-N14261

  Angiolam A	Inhibitor
  Angiolam A is an antibiotic found in Angiococcus disciformis. Angiolam A exhibits notable antibacterial activity against Gram-positive bacteria[1].

• HY-P3915

  Esculentin 1A	Inhibitor	98.85%
  Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity[1].

• HY-B0656

  Rabeprazole		98.61%
  Rabeprazole (LY307640) is a second-generation proton pump inhibitor (PPI) that irreversibly inactivates gastric H+/K+-ATPase. Rabeprazole induces apoptosis. Rabeprazole acts as an uridine nucleoside ribohydrolase (UNH) inhibitor with an IC50 of 0.3 μM. Rabeprazole can be used for the research of gastric ulcerations and gastroesophageal reflux[1][2][3].

• HY-129716

  L-693989	Inhibitor
  L-693989 is an orally active water-soluble lipopeptide with anticandidal and antipneumocystis activity. L-693989 is effective in preventing the development of both P. carinii cysts. L-693989 is promising for research of P. carinii pneumonia[1].

• HY-N6310

  Talaromycesone A
  Talaromycesone A is an oxaphenalenone dimer compound. Talaromycesone A exhibits potent antibacterial activities with an IC50 of 3.70 μM, against human pathogenic Staphylococcus strains. Talaromycesone A displays potent acetylcholinesterase inhibitory activities with an IC50 of 7.49 μM[1].

• HY-N13972

  Arylomycin B1	Inhibitor
  Arylomycin B1 is a lipohexapeptide antibiotic against Gram-positive bacteria[1].

• HY-135813

  LtaS-IN-1	Inhibitor
  LtaS-IN-1 (compound 1771) is a potent small-molecule inhibitor of Lipoteichoic acid (LTA) synthesis in multidrug-resistant (MDR) E. faecium and by altering the cell wall morphology. LtaS-IN-1 alone inhibits Enterococcus.spp 28 strains with varying MIC values ranging from 0.5 μg/mL to 64 μg/mL. LtaS-IN-1 combination with antibiotics abolishs multidrug-resistant E. faecium growth almost completely[1].

• HY-B1374R

  Florfenicol (Standard)	Inhibitor
  Florfenicol (Standard) is the analytical standard of Florfenicol. This product is intended for research and analytical applications. Florfenicol ((-)-Florfenicol) is an orally active broad-spectrum antibacterial antibiotic with anti-inflammatory, pro apoptotic, and immunomodulatory functions[6][7].

• HY-N0253R

  Hederacoside C (Standard)	Inhibitor
  Hederacoside C (Standard) is the analytical standard of Hederacoside C. This product is intended for research and analytical applications. Hederacoside C (Kalopanaxsaponin B) is an ingredient that can be obtained mainly from ivy leaves. Hederacoside C mediates inflammation by inhibiting activation of MAPK/NF-κB and its downstream signaling pathway. Hederacoside C has anti-inflammatory and antibacterial activity[1][2][3].

• HY-B1381

  Cefixime	Inhibitor	99.77%
  Cefixime (FR-17027) is an orally active antibiotic and a third generation cephalosporin antibiotic, useful for the treatment of a number of bacterial infections[1][2].

• HY-W002677

  Fluoroquinolonic acid	Inhibitor
  Fluoroquinolonic acid is a bacteriostatic antibiotic. Fluoroquinolonic acid has broad-spectrum activity against Gram-positive and Gram-negative bacteria[1].

• HY-139769

  Antibacterial agent 52	Inhibitor
  Antibacterial agent 52 (example 18) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-B0274R

  Chlorprothixene (Standard)	Inhibitor
  Chlorprothixene (Standard) is the analytical standard of Chlorprothixene. This product is intended for research and analytical applications. Chlorprothixene is a dopamine and histamine receptors antagonist with Kis of 18 nM, 2.96 nM, 4.56 nM, 9 nM and 3.75 nM for hD1, hD2, hD3, hD5 and hH1 receptors, respectively. Antipsychotic activity[1].

• HY-P5616

  Maximin H1	Inhibitor
  Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively[1].

• HY-N10097

  Chamigrenol	Inhibitor
  Chamigrenol is a Na+/K+-ATPase inhibitor with an IC50 value of 15.9 μg/mL. Chamigrenol shows strong inhibitory activities against Gram-positive and Gram-negative bacteria except Escherichia coli, with MIC values of 50 µg/mL[1].

• HY-B1422S

  9-Aminoacridine-13C6	Inhibitor
  9-Aminoacridine-13C6 is the 13C-labeled 9-Aminoacridine(HY-B1422). 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections[1][2][3].

• HY-B0333R

  Sulfamethizole (Standard)	Inhibitor
  Sulfamethizole (Standard) is the analytical standard of Sulfamethizole. This product is intended for research and analytical applications.

• HY-15306R

  Eltrombopag (Standard)	Inhibitor
  Eltrombopag (Standard) is the analytical standard of Eltrombopag. This product is intended for research and analytical applications. Eltrombopag (SB-497115) is an orally active thrombopoietin receptor nonpeptide agonist. Eltrombopag owns thrombopoietic activity, and has been used to research low blood platelet counts with chronic immune thrombocytopenia. Eltrombopag can be used for the research of cardiovascular. Eltrombopag also has highly inhibitory effects against multidrug resistant Staphylococcus aureus. Eltrombopag can induce apoptosis in hepatocellular carcinomab (HCC) as well[1][2][3][4][5].

• HY-B0400R

  D-Sorbitol (Standard)
  D-Sorbitol (Standard) is the analytical standard of D-Sorbitol. This product is intended for research and analytical applications. D-Sorbitol (Sorbitol) is a six-carbon sugar alcohol and can used as a sugar substitute. D-Sorbitol can be used as a stabilizing excipient and/or isotonicity agent, sweetener, humectant, thickener and dietary supplement[1].

• HY-W048478

  2',3'-Dideoxy-5-iodocytidine	Inhibitor	99.29%
  2',3'-Dideoxy-5-iodocytidine is used for gene sequencing can be used as an antibiotic. 2',3'-Dideoxy-5-iodocytidine is particular effective against Mycobacterium[1].

• HY-B0027R

  Valnemulin (hydrochloride) (Standard)	Inhibitor
  Valnemulin (hydrochloride) (Standard) is the analytical standard of Valnemulin (hydrochloride). This product is intended for research and analytical applications. Valnemulin (hydrochloride) is an orally effective truncated pleurotin antibiotic that inhibits protein synthesis in bacteria by binding to peptidyl transferase in the 50s ribosome subunit. Valnemulin hydrochloride effectively eliminates Mycobacterium bovis in the lungs in an experimental bovine model of Mycoplasma bovis infection. Valnemulin hydrochloride can reduce the mortality of epidemic rabbit enteropathy and has no adverse effect on the growth performance of rabbits[1][2].

• HY-W049970

  Carvacrol methyl ether	Inhibitor	99.98%
  Carvacrol methyl ether, a Carvacrol analog, can be isolated from plant volatile oil. Carvacrol methyl ether exhibits antibacterial activity[1][2].

• HY-159687

  Nafithromycin	Inhibitor
  Nafithromycin (WCK 4873) is an orally available antibiotic that inhibits community-acquired pneumonia caused by Streptococcus pneumoniae, Haemophilus influenzae, Moraxella catarrhalis, and Methicillin (HY-121544)-susceptible Staphylococcus aureus. The MIC90 of nafithromycin against macrolide-resistant and telithromycin (HY-A0062)-insensitive Streptococcus pneumoniae is 0.12 mg/liter[1].

• HY-B0356R

  Ciprofloxacin (Standard)	Inhibitor
  Ciprofloxacin (Standard) is the analytical standard of Ciprofloxacin. This product is intended for research and analytical applications. Ciprofloxacin (Bay-09867) is a potent, orally active topoisomerase IV inhibitor. Ciprofloxacin induces mitochondrial DNA and nuclear DNA damage and lead to mitochondrial dysfunction, ROS production. Ciprofloxacin has anti-proliferative activity and induces apoptosis. Ciprofloxacin is a fluoroquinolone antibiotic, exhibiting potent antibacterial activity[1][2][3][4].

• HY-N2302R

  Fucoxanthin (Standard)	Inhibitor
  Fucoxanthin (Standard) is the analytical standard of Fucoxanthin. This product is intended for research and analytical applications. Fucoxanthin (all-trans-Fucoxanthin) is a marine carotenoid and shows anti-obesity, anti-diabetic, anti-oxidant, anti-inflammatory and anticancer activities[1][2][3][4][5][6][7][8][9].

• HY-N6715

  Tenuazonic acid	Inhibitor
  Tenuazonic acid is a nonhost-selective mycotoxin belonging to the tetramic acids family. Tenuazonic acid inhibits protein biosynthesis on ribosomes by suppressing the release of new protein. Tenuazonic acid is acutely toxic, and oral LD50 is set between 81-186 mg/kg in rats and mice. Tenuazonic acid blocks electron transport beyond the primary quinone receptor (QA) by interacting with the D1 protein and is a photosystem II (PSII) inhibitor. In addition, Tenuazonic acid has antiviral effects on measles virus, enterovirus, respiratory virus and so on. Tenuazonic acid has an inhibitory effect on skin cancer[1][2][3][4][5][6][7].

• HY-P5554

  cOB1 phermone	Inhibitor
  cOB1 phermone, a bacterial sex pheromone, effectively inhibits multidrug-resistant Enterococcus faecalis V583[1].

• HY-126662

  Netzahualcoyone	Inhibitor
  Netzahualcoyone is a triterpenoid compound isolated from the Celastraceae plant family. Netzahualcoyone exhibits broad-spectrum antibiotic activity against Gram-positive bacteria and yeasts, but is not active against Gram-negative bacteria. Netzahualcoyone can be utilized in the development of antibiotics and for studying antimicrobial mechanisms[1].

• HY-130187S

  Sapienic acid-d19	Inhibitor
  Sapienic acid-d19 is a deuterated labeled Sapienic acid[1]. Sapienic acid is a fatty acid commonly found on the skin and in mucosa. Sapienic acid has variable antimicrobial activities against Gram-positive and Gram-negative bacteria found on the skin and in the oral cavity. Sapienic acid is active against Streptococcus sanguinis, Streptococcus mitis and Fusobacterium nucleatum with MBC values of 31.3 μg/mL, 375.0 μg/mL and 93.8 μg/mL, respectively[2].

• HY-147304

  BPH-1086	Inhibitor
  BPH-1086 (compound 10) is an IspH inhibitor, IspH domain fused with ribosomal protein S1 (RPS1) can bind to mRNA or form part of the bacterial ribosome[1][2].

• HY-N1151

  Thunberginol C	Inhibitor
  Thunberginol C is a natural product that can be isolated from Hydrangea macrophyll. Thunberginol C attenuates stress-induced anxiety. Thunberginol C also has antimicrobial and antiallergic activity[1][2].

• HY-B1071

  Lasalocid	Inhibitor
  Lasalocid (Lasalocid-A; Ionophore X-537A; Antibiotic X-537A) is an antibacterial and anticoccidial agent used in feed additives.

• HY-N7089

  Benzoyleneurea	Inhibitor	99.67%
  Benzoyleneurea possesses anti-bacterial activity. Benzoyleneurea scaffold can be used in the synthesis of novel protein geranylgeranyltransferase-I (PGGTase-I) inhibitors[1].

• HY-120450

  CL-55	Inhibitor
  CL-55 is an inhibitor for type three secretion system of Chlamydia trachomatis, that blocks the effector molecules delivery of bacteria into host cells. CL-55 ameliorates the C. trachomatis infection and inflammation in mice[1].

• HY-W748000

  Kocurin	Inhibitor
  Kocurin (PM181104) is a thiazolyl cyclic-peptide antibiotic. Kocurin inhibits bacterial growth by impeding bacterial protein biosynthesis during the translation phase. Kocurin has strong inhibitory activity against Gram-positive bacteria, but no activity against fungi and Gram-negative bacteria[1].

• HY-B1297

  Ceforanide	Inhibitor	99.23%
  Ceforanide is a second generation cephalosporin administered intravenously or intramuscularly. Ceforanide has a spectrum of in vitro antibacterial activity[1].

• HY-128357A

  Ibezapolstat hydrochloride	Inhibitor
  Ibezapolstat hydrochloride is a first-in-class, orally active DNA polymerase IIIC (pol IIIC) inhibitor, with a Ki of 0.325 μM for the DNA pol IIIC from C. difficile. Ibezapolstat hydrochloride is developed for the research of C. difficile infection(CDI)[1][2].

• HY-N7096

  Ceftezole sodium	Inhibitor	98.75%
  Ceftezole sodium (CTZ sodium) is a broad-spectrum cephem antibiotic against many species of gram-positive and gram-negative bacteria. Ceftezole sodium (CTZ sodium) is an alpha-glucosidase inhibitor with in vivo anti-diabetic activity[1][2].

• HY-136440S

  Hydroxymetronidazole-d4	Inhibitor
  Hydroxymetronidazole-d4 is the deuterium labeled Hydroxymetronidazole. Hydroxymetronidazole (Metronidazole-OH) is a metabolite of Metronidazole belonging to the class of nitroimidazoles. Hydroxymetronidazole can be used for the research of certain bacterial and protozoal diseases in poultry, swine dysentery and genital trichomoniasis in cattle[1].

• HY-P5627

  XT-4	Inhibitor
  XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-4 has strong activity against E.coli, the vaule of MIC is 18 μM[1].

• HY-P10565

  (RFR)4XB	Inhibitor
  (RFR)4XB is a cationic membrane-penetrating peptide. (RFR)4XB carries its cargo (the antisense oligomer) across the outer membrane of gram-negative bacteria[1].

• HY-15142A

  Doxorubicin	Inhibitor
  Doxorubicin (Hydroxydaunorubicin), a broad-spectrum anthracycline antibiotic with cytotoxic properties, is an anti-cancer chemotherapy agent. Doxorubicin has fluorescence properties. Doxorubicin inhibits topoisomerase II with an IC50 of 2.67 μM, thus stopping DNA replication. Doxorubicin reduces basal phosphorylation of AMPK and its downstream target acetyl-CoA carboxylase. Doxorubicin induces apoptosis and autophagy[1][2]. Doxorubicin inhibits human DNA topoisomerase I with an IC50 of 0.8 μM[3].

• HY-A0277R

  Cyproconazole (Standard)	Inhibitor
  Cyproconazole (Standard) is the analytical standard of Cyproconazole. This product is intended for research and analytical applications. Cyproconazole is a triazole fungicide used in agriculture to protect crops from various fungal pathogens.

• HY-P0263A

  Dermaseptin TFA	Inhibitor	99.21%
  Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration[1].

• HY-22252

  4-Aminosalicylic acid hemicalcium	Inhibitor
  4-Aminosalicylic acid hemicalcium is an orally active antibiotic and has the potential for tuberculosis research[1].

• HY-N6005

  Methyl caffeate	Inhibitor	99.89%
  Methyl caffeate, an antimicrobial agent, shows moderate antimicrobial and prominent antimycobacterial activities. Methyl caffeate also exhibits α-glucosidase inhibition activity, oxidative stress inhibiting activity, anti-platelet activity, antiproliferative activity in cervix adenocarcinoma and anticancer activity in lung and leukmia cell lines[1].

• HY-130187A

  Sapienic acid sodium	Inhibitor
  Sapienic acid sodium is a fatty acid commonly found on the skin and in mucosa. Sapienic acid sodium has variable antimicrobial activities against Gram-positive and Gram-negative bacteria found on the skin and in the oral cavity. Sapienic acid sodium is active against Streptococcus sanguinis, Streptococcus mitis and Fusobacterium nucleatum with MBC values of 31.3 μg/mL, 375.0 μg/mL and 93.8 μg/mL, respectively[1].

• HY-W001189

  1,3-Dithiane	Inhibitor
  1,3-Dithiane is a protected formaldehyde anion equivalent that could serve as a useful labeled synthon[1]. 1,3-Dithiane is also a sulfur-containing Maillard reaction products (MRPs) found in boiled beef extracts. 1,3-Dithiane shows a potent direct-acting mutagenicity toward S. typhimurium TA98 and TA100[2].

• HY-B0965R

  Thioridazine (hydrochloride) (Standard)	Inhibitor
  Thioridazine (hydrochloride) (Standard) is the analytical standard of Thioridazine (hydrochloride). This product is intended for research and analytical applications. Thioridazine hydrochloride, an orally active antagonist of the dopamine receptor D2 family proteins, exhibits potent anti-psychotic and anti-anxiety activities. Thioridazine hydrochloride is also a potent inhibitor of PI3K-Akt-mTOR signaling pathways with anti-angiogenic effect. Thioridazine hydrochloride shows antiproliferative and apoptosis induction effects in various types of cancer cells, with specificity on targeting cancer stem cells (CSCs)[1][2][3][4].

• HY-123271

  Ro 23-9424	Inhibitor
  Ro 23-9424 is a broad-spectrum cephalosporin composed of a cephalosporin and a quinolone moiety. Ro 23-9424 shows antimicrobial activity in vivo and in vitro[1][2][3].

• HY-N0717R

  L-Valine (Standard)	Inhibitor
  L-Valine (Standard) is the analytical standard of L-Valine. This product is intended for research and analytical applications. L-Valine (Valine) is a new nonlinear semiorganic material. L-Valine standrd causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine standrd inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase[1][2][3].

• HY-118660

  Anhydrotetracycline hydrochloride	Inhibitor	99.68%
  Anhydrotetracycline hydrochloride, a tetracycline biosynthetic precursor, is a potent competitive broad-spectrum tetracycline destructase enzymes inhibitor. Anhydrotetracycline hydrochloride is an effector for tetracycline controlled gene expression systems in eukaryotic cells[1].

• HY-168946

  InhA-IN-9	Inhibitor
  InhA-IN-9 (compound 7h) is a Mycobacterium tuberculosis InhA (an enoyl ACP-reductase) inhibitor. InhA-IN-9 could bind to InhA. InhA-IN-9 shows a antituberculosis activity at MIC value of 2 μg/mL[1].

• HY-135285

  Rifamexil	Inhibitor
  Rifamexil is an antibiotic Rifamycin (HY-B1907A) derivative that is active against Mycobacterium avium complex and other mycobacteria[1].

• HY-108402AR

  Cefodizime (sodium) (Standard)	Inhibitor

• HY-14881

  Bedaquiline	Inhibitor	99.98%
  Bedaquiline (TMC207) is a diarylquinoline agent and inhibits Mycobacterium tuberculosis (Mtb) F1FO-ATP synthase through targeting of both the c- and the ε-subunit[1]. Bedaquiline has uncoupler activity. Bedaquiline is used for the multi-agent resistant tuberculosis[2].

• HY-B0200AR

  Cephalexin (hydrochloride) (Standard)	Inhibitor

• HY-139739

  Antibacterial agent 31	Inhibitor
  Antibacterial agent 31 shows the antibacterial activity against rice bacterial leaf streak.

• HY-N8501

  Emestrin	Inhibitor
  Emestrin is a mycotoxin originally isolated from E. striata that has antimicrobial, immunomodulatory, and cytotoxic activities. It is active against the fungi C. albicans and C. neoformans, as well as the bacteria E. coli, S. aureus, and methicillin-resistant S. aureus (MRSA; IC50s=3.94, 0.6, 2.21, 4.55, and 2.21 μg/mL, respectively).2 Emestrin is a chemokine (C-C motif) receptor 2 (CCR2) antagonist (IC50=5.4 μM in a radioligand binding assay using isolated human monocytes).3 Emestrin (0.1 μg/mL) induces apoptosis in HL-60 cells. It induces heart, thymus, and liver tissue necrosis in mice when administered at doses ranging from 18 to 30 mg/kg.

• HY-14780

  Viquidacin	Inhibitor
  Viquidacin (NXL 101) is an antibiotic with inhibitory activity against topoisomerase IV and DNA gyrase. Viquidacin exhibits antibacterial activity against gram positive bacterial by inhibiting the supercoiling, decatenation and relaxation in strains Staphylococcus aureus and Escherichia coli in micromolar levels. Viquidacin inhibits S. aureus wildtype and mutants with MIC of 2-128 mg/L[1].

• HY-B0848R

  Tricyclazole (Standard)	Inhibitor
  Tricyclazole (Standard) is the analytical standard of Tricyclazole. This product is intended for research and analytical applications. Tricyclazole is a pentaketide-derived melanin biosynthesis inhibitor and a unique fungicide for control of Pyricularia oryzae on rice[1][2].

• HY-B1431S2

  Butylparaben-d9	Inhibitor
  Butylparaben-d9 (Butyl parahydroxybenzoate-d9; Butyl paraben-d9) is a deuterium labeled Butylparaben (HY-B1431).

• HY-105932R

  Lexithromycin (Standard)	Inhibitor

• HY-134215

  cis-11-Methyl-2-dodecenoic acid	Modulator
  cis-11-Methyl-2-dodecenoic acid is a quorum sensing (QS) signal that acts as a diffusion signaling factor (DSF) in extracellular microbial and fungal communication systems. DSF is involved in the regulation of virulence and biofilm formation of a variety of bacterial pathogens[1].

• HY-B1137S

  Ramifenazone-d7	Inhibitor
  Ramifenazone-d7 is the deuterium labeled Ramifenazone. Ramifenazone (Isopropylaminoantipyrine) is a pyrazole derivative and acts as a non-steroidal anti-inflammatory agent (NSAID). Ramifenazone has analgesic, antipyretic, anti-inflammatory and antimicrobial activities[1][2].

• HY-109754

  Sulopenem etzadroxil	Inhibitor	99.05%
  Sulopenem etzadroxil (PF-03709270) is an orally available ester proagent form of sulopenem, with broad-spectrum antibacterial activity against most gram-positive and gram-negative bacteria.

• HY-155846

  Antileishmanial agent-22	Inhibitor
  Antileishmanial agent-22 (compound 15b) is a parasite inhibitor and an antibacterial agent, with antileishmanial, antimalarial, and anti-tubercular activities. Antileishmanial agent-22 inhibits leishmanial (IC50=0.408 μM) based on antifolate mechanism. And, Antileishmanial agent-22 inhibits Folic acid and Folinic acid at 100 μM with inhibitory rates of 88% and 94%, respectively. Antileishmanial agent-22 inhibits P. berghei in vivo and in vitro, with 96.67% suppression under 48.4 μM/kg/day and 0.038 μM (IC50), respectively. Moreover, Antileishmanial agent-22 inhibits M. tuberculosis with MIC of 28.44 μM[1].

• HY-B0272S

  Rifampicin-d3	Inhibitor
  Rifampicin-d3 is the deuterium labeled Rifampicin. Rifampicin is a potent and broad spectrum antibiotic against bacterial pathogens. Rifampicin has anti-influenza virus activities[1][2].

• HY-N7068R

  Mupirocin (calcium hydrate) (Standard)	Inhibitor
  Mupirocin (calcium hydrate) (Standard) is the analytical standard of Mupirocin (calcium hydrate). This product is intended for research and analytical applications. Mupirocin (BRL-4910A, Pseudomonic acid) calcium hydrate is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin calcium hydrate apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2].

• HY-N0056

  Isochlorogenic acid A	Inhibitor
  Isochlorogenic acid A (3,5-Dicaffeoylquinic acid) is a natural phenolic acid with anti-mutagenicity, anti-HBV, anti-HIV, anti-oxidant, anti-bacterial, and anti-inflammatoryy activities[1].

• HY-B1248R

  Chlorhexidine (Standard)	Inhibitor
  Chlorhexidine (Standard) is the analytical standard of Chlorhexidine. This product is intended for research and analytical applications. Chlorhexidine is an antibacterial used as an antiseptic and for other applications. Chlorhexidine is used to clean the skin after an injury, before surgery, or before an injection. Chlorhexidine is also used to clean the hands before a procedure[1].

• HY-115440R

  CRS3123 (dihydrochloride) (Standard)	Inhibitor
  Selegiline (Standard) is the analytical standard of Selegiline. This product is intended for research and analytical applications. Selegiline (Deprenyl) is a potent, selective and irreversible inhibitor of MAO-B, with an IC50 of 51 nM. Selegiline exhibits 450-flod selectivity for MAO-B over MAO-A (IC50=23 μM). Selegiline can be used for the research of Parkinson's disease, Alzheimer's disease and major depressive disorder[1][2][3].

• HY-N6931R

  Usaramine (Standard)	Inhibitor
  Usaramine (Standard) is the analytical standard of Usaramine. This product is intended for research and analytical applications. Usaramine is a pyrrolizidine alkaloid isolated from seeds of Crolatalaria pallida. Usaramine demonstrates a highlighted antibiofilm activity against Staphylococcus epidermidis by reducing more than 50% of biofilm formation without killing the bacteria[1].

• HY-147944

  Antimicrobial agent-4	Inhibitor
  Antimicrobial agent-4 (compound 6a) is a potent antimicrobial agent. Antimicrobial agent-4 exhibits considerable activity against the microbial pathogens. Antimicrobial agent-4 delivers reliable toxicity to kill the bacteria and fungi. Antimicrobial agent-4 shows high binding energy value of −10.0 kcal/mole against the target enzyme[1].

• HY-A0256R

  Clavulanic acid (Standard)	Inhibitor

• HY-B1299A

  Cephalosporin C zinc salt	Inhibitor
  Cephalosporin C zinc salt is a potent inhibitor of SAMHD1 with an IC50 of 1.1 μM[1]. Cephalosporin C zinc salt also has moderate anti-orthopoxvirus activity[2].

• HY-B0724AR

  Pazufloxacin (mesylate) (Standard)	Inhibitor
  Pazufloxacin (mesylate) (Standard) is the analytical standard of Pazufloxacin (mesylate). This product is intended for research and analytical applications. 0

• HY-B1743

  Puromycin	Inhibitor
  Puromycin dihydrochloride is the dihydrochloride salt of puromycin. Puromycin is an aminoglycoside antibiotic that inhibits protein synthesis.

• HY-103645

  GW779439X	Inhibitor	99.85%
  GW779439X is a pyrazolopyridazine identified in an inhibitor of the S. aureus PASTA kinase Stk1. GW779439X potentiates the activity of β-lactam antibiotics against various MRSA and MSSA isolates, some even crossing the breakpoint from resistant to sensitive. GW779439X is an AURKA inhibitor and induces apoptosis by the caspases 3/7 pathway[1][2]. MRSA:methicillin-resistant S. aureus; MSSA: methicillin-sensitive S. aureus

• HY-B0507

  Sulfathiazole	Inhibitor
  Sulfathiazole, an organosulfur compound, is used as a short-acting sulfonamide antibiotic[1][2][3].

• HY-N0589

  Dehydrodiisoeugenol	Inhibitor	99.98%
  Dehydrodiisoeugenol is isolated from Myristica fragrans Houtt, shows anti-inflammatory and anti-bacterial actions[1]. Dehydrodiisoeugenol inhibits LPS- stimulated NF-κB activation and cyclooxygenase (COX)-2 gene expression in murine macrophages[2].

• HY-B0977R

  Dicloxacillin (Sodium hydrate) (Standard)	Inhibitor
  Dicloxacillin (Sodium hydrate) (Standard) is the analytical standard of Dicloxacillin (Sodium hydrate). This product is intended for research and analytical applications. Dicloxacillin Sodium hydrate (Dicloxacillin sodium salt monohydrate) is a narrow-spectrum β-Lactam antibiotic of the penicillin class, is used to treat infections caused by susceptible Gram-positive bacteria, active against beta-lactamase-producing organisms such as Staphylococcus aureus[1][2][3].

• HY-100584

  Davercin	Inhibitor
  Davercin (Erythromycin Cyclocarbonate), derivative of Erythromycin, which is active against Gram-positive and some Gram-negative microorganisms.

• HY-17006

  Caspofungin diacetate
  Caspofungin (MK-0991) diacetate is a potent antifungal agent. Caspofungin diacetate inhibits the synthesis of the fungal cell wall component β-(l,3)-D-glucan[1][2].

• HY-N0295R

  Protocatechualdehyde (Standard)	Inhibitor
  Protocatechualdehyde (Standard) is the analytical standard of Protocatechualdehyde. This product is intended for research and analytical applications. Protocatechualdehyde (Catechaldehyde), a natural polyphenol compound isolated from the roots of radix Salviae Miltiorrhizae, is associated with a wide variety of biological activities and has been widely used in medicine as an antioxidant, anti-aging, an antibacterial and anti-inflammatory agent[1].

• HY-158973

  bCSE-IN-1	Inhibitor
  bCSE-IN-1 (Compound 3i) is an inhibitor of Bacterial Cystathionine γ-lyase. bCSE-IN-1 has antibacterial activity[1].

• HY-108913

  Nitrocefin
  Nitrocefin is a highly activated, chromogenic cephalosporin derivative. Nitrocefin is a chromogenic β-lactamase substrate. Nitrocefin undergoes a distinctive color change from yellow to red as the amide bond in the β-lactam ring is hydrolyzed by β-lactamase. Nitrocefin is used in competitive inhibition studies in developmental work on β-lactamase-resistant antibiotics[1][2][3][4].

• HY-B0671

  Vancomycin	Inhibitor	99.39%
  Vancomycin is an antibiotic for the treatment of bacterial infections.

• HY-B0329

  Isoniazid	Inhibitor
  Isoniazid (INH) is a proagent and must be activated by a bacterial catalase-peroxidase enzyme KatG. Isoniazid is bactericidal to rapidly dividing mycobacteria and has anti-tuberculostatic activity[1][2][3][4].

• HY-N2041R

  Myristic acid (Standard)	Inhibitor
  Myristic acid (Standard) is the analytical standard of Myristic acid. This product is intended for research and analytical applications. Myristic acid is an orally active saturated 14-carbon fatty acid found in most animal and plant fats, especially milk fat coconut oil, palm oil and nutmeg oil. Myristic acid exerts anti-inflammatory activity through the NF-κB pathway. Myristic acid has antibacterial, anti-inflammatory and analgesic properties[1][2][3][4].

• HY-145325

  Antibacterial agent 66	Inhibitor
  Antibacterial agent 66 (Compound 6q), a trifluoromethylpyridine 1,3,4-oxadiazole derivative, shows activity against Xanthomonas oryzae pv. oryzae (Xoo) with an EC50 value of 7.2 μg/mL[1].

• HY-N13984

  Arylomycin B5	Inhibitor
  Arylomycin B5, a microbial metabolite, is a structural analog of Arylomycin B2 (HY-N13981)[1].

• HY-N0565AR

  Doxycycline (hydrochloride) (Standard)	Inhibitor
  Doxycycline (hydrochloride) (Standard) is the analytical standard of Doxycycline (hydrochloride). This product is intended for research and analytical applications. Doxycycline hydrochloride, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline hydrochloride shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-B0656AS2

  Rabeprazole-d4 potassium
  Rabeprazole-d4 potassium is deuterated labeled Rabeprazole sodium (HY-B0656A). Rabeprazole sodium (LY307640 sodium) is a second-generation proton pump inhibitor (PPI) that irreversibly inactivates gastric H+/K+-ATPase. Rabeprazole sodium induces apoptosis. Rabeprazole sodium acts as an uridine nucleoside ribohydrolase (UNH) inhibitor with an IC50 of 0.3 μM. Rabeprazole sodium can be used for the research of gastric ulcerations and gastroesophageal reflux[1][2][3].

• HY-N2388

  Auraptene	Inhibitor	99.96%
  Auraptene is an orally active geranyloxycoumarin that can be isolated from plants in the Brassicaceae family, antibacterial, anti-pathogen, antioxidant, anti-tumor, and neuroprotective effects. Auraptene plays an important role in the treatment of various chronic diseases such as hypertension and cystic fibrosis[1][2].

• HY-B0848

  Tricyclazole	Inhibitor	98.64%
  Tricyclazole is a pentaketide-derived melanin biosynthesis inhibitor and a unique fungicide for control of Pyricularia oryzae on rice[1][2].

• HY-156421

  QST4		99.23%
  QST4 has antitubercular activity, with the MIC value of 6.25 μM in Mycobacterium tuberculosis H37Rv[1].

• HY-158296

  Tetracycline/OVA	Inhibitor
  Tetracycline/OVA is a biochemical reagent that can be used as a biological material or organic compound for life science related research[1].

• HY-119938

  Tuberculosis inhibitor 1	Inhibitor
  Tuberculosis inhibitor 1 is a potent and non-cytotoxic trypanosoma brucei growth inhibitor with an EC50 of 5 nM[1].

• HY-139767

  Antibacterial agent 50	Inhibitor
  Antibacterial agent 50 (example 47) is an antibacterial agent with MIC values of 32 mcg/mL, 64 mcg/mL, and 128 mcg/mL against E. coli strains NCTC 13351, M 50 and 7 MP, respectively (WO2013030733A1)[1].

• HY-B0671S3

  Vancomycin-d10 TFA	Inhibitor
  Vancomycin-d10 (TFA) is a deuterated labeled Vancomycin[1]. Vancomycin is an antibiotic for the treatment of bacterial infections.

• HY-W039897

  Methyl α-D-mannopyranoside
  Methyl α-D-mannopyranoside could target macrophages in anti-tuberculosis inhalation therapy[1].

• HY-155648

  Tuberculosis inhibitor 6	Inhibitor
  Tuberculosis inhibitor 6 (compound 2c) is a 3-methoxy-2-phenylimidazo[1,2-b]pyridazine derivative that shows highly active against Mycobacterium tuberculosis (MIC90 of ≤1.66 μM) and Mycobacterium marinum (MIC90 of 2.65 μM)[1].

• HY-30219R

  D-​(+)​-​Phenyllactic acid (Standard)	Inhibitor

• HY-146300

  Mt KARI-IN-4	Inhibitor
  Mt KARI-IN-4 (compound 5c) is a potent Mycobacterium tuberculosis ketol-acid reductoisomerase (Mtb KARI) inhibitor with a Ki value of 5.48 μM. Mt KARI-IN-4 has inhibitory activity against Mtb H37Rv (MIC = 0.78 μM) and low cytotoxicity (HEK IC50 > 72 μg/mL)[1].

• HY-137371R

  Lactonic sophorolipid (Standard)	Inhibitor
  Lovastatin hydroxy acid (sodium) (Standard) is the analytical standard of Lovastatin hydroxy acid (sodium). This product is intended for research and analytical applications. Lovastatin hydroxy acid sodium (Mevinolinic acid sodium) is a highly potent inhibitor of HMG-CoA reductase with a Ki of 0.6 nM[1].

• HY-139771

  Antibacterial agent 54	Inhibitor
  Antibacterial agent 54 (example 20) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-146463

  NusB-IN-1	Inhibitor
  NusB-IN-1 (Compound 22r) is a potent, orally active bacterial rRNA synthesis inhibitor. NusB-IN-1 shows antimicrobial activity against MRSA and VRSA[1]. NusB-IN-1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-126461

  Salazinic acid	Inhibitor
  Salazinic acid has antibacterial activity against bacteria and fungi. Salazinic acid does not show antibacterial activity against Listeria monocytogenes, Pseudomonas aeruginosa, Yersinia enterocolitica, and Enterococcus faecalis, but it does have antibacterial activity against Pseudomonas aeruginosa and Salmonella typhimurium[1].

• HY-14990A

  Sudoterb hydrochloride	Inhibitor
  Sudoterb (LL 3858) hydrochloride is an orally active anti-Tuberculosis agent[1].

• HY-17025R

  Rifabutin (Standard)	Inhibitor
  Rifabutin (Standard) is the analytical standard of Rifabutin. This product is intended for research and analytical applications. Rifabutin (Ansamycin) is a semisynthetic ansamycin antibiotic with potent antimycobacterial properties. Rifabutin inhibits DNA-dependent RNA polymerase.

• HY-163291

  AM4085	Antagonist
  AM4085 is an orally active Antagonist for FmlH with an IC50 of 0.19 μM. AM4085 reveals metabolic stability in mouse liver microsomes and blood plasma[1].

• HY-135221

  Cefcapene pivoxil hydrochloride	Inhibitor	99.05%
  Cefcapene pivoxil hydrochloride, the pivalate ester prodrug form of Cefcapene, is an orally active third-generation cephalosporin with a wide spectrum of anti-bacterial activity. Cefcapene pivoxil hydrochloride has the potential for the palmoplantar pustulosis (PPP) research[1][2].

• HY-N2026A

  Propylparaben sodium	Inhibitor
  Propylparaben sodium (Propyl parahydroxybenzoate) is an antimicrobial preservative which can be produced naturally by plants and bacteria. Propylparaben sodium is prevalently used in cosmetics, pharmaceuticals, and foods. Propylparaben sodium disrupts antral follicle growth and steroidogenic function by altering the cell-cycle, apoptosis, and steroidogenesis pathways. Propylparaben sodium also decreases sperm number and motile activity in rats[1][2][3].

• HY-P5642

  Retrocyclin-101	Inhibitor
  Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral[1].

• HY-W010243

  Methylisothiazolinone hydrochloride	Inhibitor
  Methylisothiazolinone hydrochloride is the constituent of the biocide Kathon CG. Methylisothiazolinone hydrochloride is an isothiazolone derivative widely used as a preservative. Methylisothiazolinone hydrochloride is also a moderate sensitizer and reacts with GSH[1][2].

• HY-14648C

  Dexamethasone (Water Soluble)	Inhibitor
  Dexamethasone (Hexadecadrol) Water Soluble is a water-soluble form of Dexamethasone (HY-14648). Dexamethasone is a glucocorticoid receptor agonist, apoptosis inducer, and a common disease inducer in experimental animals. It can be used to construct models of muscle atrophy, hypertension, and depression. Dexamethasone can inhibit the production of inflammatory miRNA-155 exosomes in macrophages and significantly reduce the expression of inflammatory factors in neutrophils and monocytes. Dexamethasone also has the potential to be used in COVID-19 research[1].

• HY-N0312

  Rhein-8-glucoside calcium	Inhibitor
  Rhein-8-glucoside calcium, an anthraquinone compound, is isolated from the EtOH extract of the roots of Saussurea lappa. Rhein-8-glucoside calcium is an hPTP1B inhibitor, with an IC50 of 11.5 μM. Rhein-8-glucoside calcium has antibacterial effects[1][2].

• HY-B1246

  Thonzonium bromide	Inhibitor	99.86%
  Thonzonium bromide is an antibacterial agent that is structurally similar to Farnesol (HY-Y0248A). Thonzonium bromide is also a monocationic surface-active agent, which inhibits RANKL-induced osteoclast formation and bone resorption in vitro and prevents LPS-induced bone loss in vivo. Thonzonium bromide inhibits proton transport in a dose-dependent manner (EC50=69 μM)[1][2][3].

• HY-16566AR

  Kanamycin (sulfate) (Standard)	Inhibitor
  Kanamycin (sulfate) (Standard) is the analytical standard of Kanamycin (sulfate). This product is intended for research and analytical applications. Kanamycin (Kanamycin A) sulfate is an orally active antibacterial (gram-negative/positive bacteria) agent, inhibits translocation and causes misencoding by binding to the 70 S ribosomal subunit. Kanamycin sulfate shows good inhibitory activity to both M. tuberculosis (sensitive and drug-resistant ) and K. pneumonia, which can be used in studies of tuberculosis and pneumonia[1][2][3][4].

• HY-100597

  Saponins
  Saponins (Saponin) is a class of chemical compound of glycosides found in particular abundance in various plant species. In plants, Saponins may serve as anti-feedants, and to protect the plant against microbes and fungi[1].

• HY-152668

  Urease-IN-4	Inhibitor
  Urease-IN-4 is an effective inhibitor of urease with an IC50 value of 1.64 µM. Urease-IN-4 has low cytotoxicity and shows inhibitory activity on P. vulgaris with an IC50 value of 15.27 µg/mL[1].

• HY-136441S

  Triclosan-methyl-d3	Inhibitor
  Triclosan-methyl-d3 is the deuterium labeled Triclosan-methyl. Triclosan-methyl is a transformation product of triclosan. Triclosan is a bactericide in personal care products such as toothpaste, shampoos, and soaps. Triclosan is also a stabilizing agent in a multitude of detergents and cosmetics[1].

• HY-141641

  N-(3-Oxopentanoyl)-L-homoserine lactone
  N-(3-Oxopentanoyl)-L-homoserine lactone is an autoinducer, a kind of chemical signal molecule which passively diffuses across the bacterial envelope and accumulates intracellularly at high bacterial densities. It may bind to a protein related to the LuxR protein of V. fischeri and causes cell density-dependent gene expression. N-(3-Oxopentanoyl)-L-homoserine can be used for research of quorum sensing[1].

• HY-N13196

  Arcopilin A	Inhibitor
  Arcopilin A (compound Arcopilin A(1))is an antibacterial agent. Arcopilin A has weak inhibitory effects on fungal pathogens and Gram-positive bacteria, with IC50 values of 8.9 μg/mL and 14 μg/mL for cells KB-3-1 and L929, but it can effectively destroy preformed biofilms of Staphylococcus aureus. Arcopilin A can enhance the activities of gentamicin (GM; HY-K1050) and vancomycin (Vac; HY-B0671) by 115 and 31 times, respectively[1].

• HY-117145

  Thiophene-2	Inhibitor
  Thiophene-2 (TP2) is a specific polyketide synthase 13 (Pks13) inhibitor. Thiophene-2 inhibits mycolic acid biosynthesis and rapidly leads to mycobacterial cell death. Thiophene-2 is active against Mycobacterium tuberculosis with a MIC value of 1 μM, and has potent anti-tuberculosis activity[1].

• HY-157573

  N-Acetylmuramic acid-azide	Inhibitor
  N-Acetylmuramic acid-azide (Compound 2) is a derivative of N-acetylaminoacetic acid (NAM) in bacterial peptidoglycan. Incorporated into bacterial peptidoglycan during biosynthesis[1].

• HY-12930

  SPR719	Inhibitor	99.50%
  SPR719 (VXc-486) is an orally active gyrase B inhibitor, with bactericidal activity. SPR719 potently inhibits multiple agent-sensitive isolates and drug-resistant isolates of Mycobacterium tuberculosis, with MICs of 0.03 to 0.30 μg/ml and 0.08 to 5.48 μg/ml, respectively. SPR719 is promising for research of lung disease caused by non-tuberculous mycobacteria (NTM)[1][2][3][4].

• HY-150166

  ClpB-IN-1	Inhibitor	98.00%
  ClpB-IN-1 (compound 7) is a potent ClpB inhibitor. ClpB-IN-1 is a potential antibacterial agents[1].

• HY-158003

  COE-PNH2
  COE-PNH2 exhibits antibacterial activity against Mycobacterium abscessus (Mab) with MIC90 of 26 μM. COE-PNH2 affects the integrity of the bacterial envelope and mycomembrane. COE-PNH2 reveals intracelluar penetration without mitochondrial toxicity[1].

• HY-B1290R

  2-Phenylethanol (Standard)	Inhibitor
  2-Phenylethanol (Standard) is the analytical standard of 2-Phenylethanol. This product is intended for research and analytical applications. 2-Phenylethanol (Phenethyl alcohol) is an aromatic alcohol with a rose-like odour. 2-Phenylethanol is a flavour and fragrance compound, and can be used as a preservative and anti-microbial agent. 2-Phenylethanol has antityrosinase and antimicrobial activities[1][2].

• HY-B0946

  Sulfamonomethoxine	Inhibitor
  Sulfamonomethoxine is a long acting sulfonamide antibacterial agent, used in blood kinetic studies,and blocks the synthesis of folic acid by inhibiting synthetase of dihydropteroate.

• HY-Y1718

  Tridecanoic acid	Inhibitor
  Tridecanoic acid (N-Tridecanoic acid), a 13-carbon medium-chain saturated fatty acid, can serve as an antipersister and antibiofilm agent that may be applied to research bacterial infections. Tridecanoic acid inhibits Escherichia coli persistence and biofilm formation[1].

• HY-W014316

  5-Bromo-5-nitro-1,3-dioxane	Inhibitor	99.89%
  5-Bromo-5-nitro-1,3-dioxane, an antimicrobial compound, is effective against Gram-positive and Gram-negative bacteria and fungi, including yeast. 5-Bromo-5-nitro-1,3-dioxane inhibits enzyme activity and subsequent inhibition of microbial growth by the oxidation of essential protein thiol[1].

• HY-116571

  RU44790
  RU44790 is a monocyclic beta-lactam antibiotic that exerts potent activity against gram-negative bacteria and is highly resistant to hydrolysis by various beta-lactamases. RU44790 can be utilized in anti-bacteria research[1].

• HY-W088872S

  (R)-2-Methylbutanoic acid-d3
  (R)-2-Methylbutanoic acid-d3 is the deuterium labeled (R)-2-Methylbutanoic acid[1].

• HY-W075256

  Isotianil		98.13%
  Isotianil is a plant defense inducer that has no direct antimicrobial effect but instead activates typical plant defense responses. Isotianil can be used as a plant protection agent for controlling rice blast[1].

• HY-159809

  Antibacterial agent 249	Inhibitor
  Antibacterial agent 249 demonstrates broad-spectrum antimicrobial properties, effectively inhibiting the growth of Aspergillus niger, Bacillus subtilis, Pseudomonas albicans, Escherichia coli, and Staphylococcus aureus, while also exhibiting anti-inflammatory activity in vitro, making it a potential candidate for treating bacterial infections.

• HY-B1674R

  (±)-Leucine (Standard)	Inhibitor
  (±)-Leucine (Standard) is the analytical standard of (±)-Leucine. This product is intended for research and analytical applications. (±)-Leucine (DL-Leucine), an isomer of Leucine, chemosterilant and dietary additive. (±)-Leucine inhibits growth of Escherichia coli HfrH by 92.08%[1].

• HY-116519

  LY173013	Inhibitor
  LY173013 is an antibacterial agent with a broad spectrum antibacterial activity. LY173013 binds to PBP 3 of E.coli and can be utilized in antibacterial research[1].

• HY-P5557

  TP4 (Nile tilapia piscidin)	Inhibitor
  TP4 (Nile tilapia piscidin) is an orally active piscidin-like antimicrobial peptide. TP4 inhibits multiple gram positive and negative strains (MIC: 0.03-10 μg/mL). TP4 shows hemolytic activities. TP4 enhances immune response, antioxidant activity, and intestinal health against bacterial infections. TP4 also has anti-tumor effect, and induces necrosis by triggering mitochondrial dysfunction in cancer cells[1][2][3].

• HY-A0256BR

  Clavulanate (lithium) (Standard)	Inhibitor
  Clavulanate (lithium) (Standard) is the analytical standard of Clavulanate (lithium). This product is intended for research and analytical applications. Clavulanate lithium is a potent β-lactamase inhibitor and acts as an antibiotic[1][2].

• HY-146811

  HSGN-94	Inhibitor
  HSGN-94 is a potent antimicrobial agent with lipoteichoic acid (LTA) biosynthesis inhibition. HSGN-94 inhibits drug-resistant Gram-positive bacteria with MIC values of 0.25-2 μg/mL. HSGN-94 inhibits biofilm formation of MRSA and Vancomycin-resistant Enterococci. HSGN-94 also inhibits pro-inflammatory cytokines, exhibits in vivo efficacy in an MRSA murine wound infection model[1].

• HY-B0946S1

  Sulfamonomethoxine-d3	Inhibitor
  Sulfamonomethoxine-d3 is the deuterium labeled Sulfamonomethoxine. Sulfamonomethoxine is a long acting sulfonamide antibacterial agent, used in blood kinetic studies,and blocks the synthesis of folic acid by inhibiting synthetase of dihydropteroate.

• HY-101444A

  PAβN dihydrochloride	Inhibitor	99.89%
  PAβN dihydrochloride (MC-207110 dihydrochloride) is an efflux pump inhibitor.

• HY-128525R

  Enterobactin (Standard)
  Enterobactin (Standard) is the analytical standard of Enterobactin. This product is intended for research and analytical applications. Enterobactin is a siderophore produced by Gram-negative bacteria and has an extremely high affinity for iron. During the process of Salmonella typhimurium infecting macrophages, Enterobactin can not only help bacteria uptake iron but also reduce the antibacterial activity of macrophages. In addition, Enterobactin is also involved in the oxidative stress response of Escherichia coli. Enterobactin can be hydrolyzed by Fes in the cell and exert antioxidant effects by scavenging free radicals[1].

• HY-66011R

  Moxifloxacin (Hydrochloride) (Standard)	Inhibitor
  Moxifloxacin (Hydrochloride) (Standard) is the analytical standard of Moxifloxacin (Hydrochloride). This product is intended for research and analytical applications. Moxifloxacin Hydrochloride (BAY 12-8039) is an oral 8-methoxyquinolone antimicrobial for use in the treatment of acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1][2].

• HY-W004294R

  1-Tetradecanol (Standard)	Inhibitor
  1-Tetradecanol (Standard) is the analytical standard of 1-Tetradecanol. This product is intended for research and analytical applications. 1-Tetradecanol, isolated from Myristica fragrans, is a straight-chain saturated fatty alcohol. 1-Tetradecanol possesses antibacterial and anti-inflammatory (periodontitis) activity[1].

• HY-17439

  Salinomycin sodium salt	Inhibitor
  Salinomycin sodium salt (Salinomycin sodium), an antibiotic potassium ionophore, is a potent inhibitor of Wnt/β-catenin signaling. Salinomycin sodium salt (Salinomycin sodium) acts on the Wnt/Fzd/LRP complex, blocks Wnt-induced LRP6 phosphorylation, and causes degradation of the LRP6 protein. Salinomycin sodium salt (Salinomycin sodium) shows selective activity against human cancer stem cells[1][2][3].

• HY-N1654

  2',3'-Dehydrosalannol	Inhibitor
  2',3'-Dehydrosalannol is a potent antibacterial agent. 2',3'-Dehydrosalannol shows antibacterial activity against K. pneumonia ATCC 13883, P. aeruginosa ATCC 27853, S. aureus ATCC 25922, E. coli ATCC 11775, and E. faecalis ATCC 10541, with MIC values of 0.78, 1.56, 1.56, 6.25, and 25 µg/mL, respectively[1].

• HY-B1366R

  Meclocycline (Sulfosalicylate Salt) (Standard)	Inhibitor
  Meclocycline (Sulfosalicylate Salt) (Standard) is the analytical standard of Meclocycline (Sulfosalicylate Salt). This product is intended for research and analytical applications. Meclocycline Sulfosalicylate Salt is a tetracycline antibiotic with broad-spectrum antibacterial activities, preventing skin bacterial infections such as acne vulgaris[1].

• HY-163571

  CYP51-IN-17	Inhibitor
  CYP51-IN-17 (compound 7a) is a potent CYP51 inhibitor with an IC50 of 0.377 μg/mL. CYP51-IN-17 shows significant fungicidal activity against B. cinerea with an EC50 of 0.326 μg/mL[1].

• HY-P10785

  Iturin A-2	Inhibitor
  Iturin A-2 is a cyclic lipopeptide discovered in B. subtilis and exhibits inhibitory activity against the plant pathogenic fungus P. expansum (MIC = 8 µg/disk). Iturin A-2 is cytotoxic to MCF-7 and BT474 breast cancer cells, as well as HeLa cervical cancer cells, with IC50 values of 66.81, 95.04, and 77.5 µg/mL, respectively. In greenhouse studies, Iturin A-2 at concentrations of 100 and 300 mg/kg Iturin A-2 reduces the lesion area of southern corn leaf blight caused by B. maydis, and in field studies, concentrations of 300 and 500 mg/kg Iturin A-2 reduce the incidence of the disease. Iturin A-2 (12.5 µg/mL) inhibits cell division, but not nuclear division, in isolated fertilized starfish eggs[1][2][3][4].

• HY-136306

  Metallo β-lactamase ligand 1	Inhibitor	99.60%
  Metallo-beta-lactamase ligand 1 is a class B β-lactamase inhibitor with antibacterial activity extracted from patent WO2019221122A1, compound A[1].

• HY-119606

  Bacimethrin	Inhibitor
  Bacimethrin (NSC 66577) is an antibacterial agent and is thiamin biosynthesis antagonist.Bacimethrin inhibits bacterial and yeast growth[1][2].

• HY-W107077

  INF55	Inhibitor
  INF55 is a NoA multidrug resistance pump inhibitor with the activity of inhibiting the NoA pump. The heterocomplex formed by INF55 combined with berberine shows the potential to combat the resistance of bacterial compounds. INF55 can enhance the antibacterial activity of berberine by reducing its efflux. The structural variants of INF55 can show different NoA inhibitory activities, thereby affecting the antibacterial effect of its corresponding heterocomplexes. Different derivatives of INF55 show similar activity in terms of antibacterial dose and effectiveness[1].

• HY-108357

  6-Diazo-5-oxo-L-nor-Leucine	Inhibitor
  6-Diazo-5-oxo-L-nor-Leucine (L-6-Diazo-5-oxonorleucine; DON) is a glutamine antagonist that irreversibly inhibits the catabolic effect of glutamine. 6-Diazo-5-oxo-L-nor-Leucine shows good anticancer activity (especially in pancreatic cancer) and reduces the self-renewal potential and metastatic capacity of tumour cells. 6-Diazo-5-oxo-L-nor-Leucine also possesses antibacterial and antiviral activity[1][2][3].

• HY-111019A

  SCH 34343 sodium	Inhibitor
  SCH 34343 sodium is a potent β-lactam Antibiotic with bactericidal activity against Streptococcus pneumoniae, viridans streptococci, streptococci of groups A, B, C and G, and Str. bovis[1].

• HY-155720

  Mtb-IN-4	Inhibitor
  Mtb-IN-4 (compound 17h) is a nontoxic isoxazole, with anti-Mycobacterium tuberculosis (Mtb) activity (IC50=0.70 μM). Mtb-IN-4 inhibits Mtb respiration and biofilm formation in macrophage, and enhances antibiotic isoniazid (INH) inhibition against INH-resistant Mtb mutant[1].

• HY-139755

  Antibacterial agent 38	Inhibitor
  Antibacterial agent 38 is an antibacterial agent extracted from patent WO2015063714A1, compound C. Antibacterial agent 38 can be used for the research of bacterial infections[1].

• HY-P10538

  Balteatide	Inhibitor
  Balteatide is an antimicrobial peptide, which can be found in skin secretion of Phyllomedusa baltea. Balteatide inhibits the gram-positive Staphylococcus aureus (MIC=435 μM), the gram-negative Escherichia coli (MIC=109 μM), and Candida albicans (MIC=27 μM). Balteatide lacks hemolytic activity (at 512 mg/L) and myotropic activity[1].

• HY-B0330BS1

  Levofloxacin-d3 hydrochloride	Inhibitor
  Levofloxacin-d3 ((-)-Ofloxacin-d3) hydrochlorideis deuterium labeled Levofloxacin (hydrochloride). Levofloxacin ((-)-Ofloxacin) hydrochloride is an orally active antibiotic and is active against both Gram-positive and Gram-negative bacteria. Levofloxacin hydrochloride inhibits the DNA gyrase and topoisomerase IV. Levofloxacin hydrochloride can be used for chronic periodontitis, airway inflammation and BK Viremia research. Levofloxacin hydrochloride shows anti-orthopoxvirus activity[1][2][3][4][5][6].

• HY-163915

  8-(4-(Trifluoromethyl)anilino)quercetin	Inhibitor
  8-(4-(Trifluoromethyl)anilino)quercetin is a potent ErmA inhibitor. 8-(4-(Trifluoromethyl)anilino)quercetin has antioxidant and anti-inflammatory activity[1].

• HY-P10681

  Crabrolin	Inhibitor
  Crabrolin is a tridecapeptide that can be extracted from the venom of the European hornet (Vespa crabro). Crabrolin shows MIC/MBC of 2/2, 16/64, 4/8 μM, for S. aureus (NCTC 10788), MRSA (NCTC 12493) and E. faecium (NTCC 12697), respectively[1].

• HY-126170

  Valanimycin	Inhibitor
  Valanimycin is an antibiotic, which inhibits Escherichia coli (BE1121) through interaction with DNA. Valanimycin exhibits cytotoxicity to mouse leukemia L1210, P388/S (doxorubicin (HY-15142A)-sensitive), and P388/ADR (doxorubicin-resistant), with IC50 of 0.79, 2.65, and 1.44 μg/mL, respectively. Valanimycin exhibits antitumor efficacy against ehrlich ascites tumors or L1210 in mice[1].

• HY-139597

  Temocillin disodium	Inhibitor
  Temocillin disodium, a 6-α-methoxy penicillin, possesses antibacterial activity[1].

• HY-105751

  Kalafungin	Inhibitor
  Kalafungin is an antibiotic, antimicrobial agent and a β-lactamase inhibitor from marine Streptomyces, with IC50 of 225.37 μM. Kalafungin destroys cell membranes. Kalafungin shows inhibitory activities against a variety of pathogenic fungi, yeasts, protozoa, gram-positive bacteria (such as S. aureus ATCC 33591 and S. aureus ATCC 23591), and, to a lesser extent, gram-negative bacteria[1][2].

• HY-N1377

  Nevadensin	Inhibitor	99.93%
  Nevadensin is a naturally occurring selective inhibitor of human carboxylesterase 1 (hCE1) with an IC50 of 2.64 μM. Nevadensin has a variety of pharmacological effects such as anti-mycobacterium tuberculosis activities, antitussive, anti-inflammatory and anti-hypertensive[1][2].

• HY-N0716BR

  Berberine (sulfate) (Standard)	Inhibitor

• HY-125579

  Ro 25-0534	Inhibitor	98.31%
  Ro 25-0534 is an antimicrobial compound against Pseudomonas. Ro 25-0534 is active against Enterobacteriaceae (MIC90: 0.06-2 μg/mL), Oxacillin (HY-B0465)-susceptible staphylococci, β-hemolytic streptococci, and penicillin-susceptible pneumococci (MIC90: 1-2 μg/mL), Haemophilus influenzae (MIC90: 0.25-0.5 μg/mL), Moraxella catarrhalis (MIC90: 0.5 μg/mL), and most nonenteric Gram-negative bacilli (MIC90: 2-4 μg/mL)[1].

• HY-17594R

  Oxyclozanide (Standard)	Inhibitor
  Oxyclozanide (Standard) is the analytical standard of Oxyclozanide. This product is intended for research and analytical applications. Oxyclozanide is an orally active salicylanilide anthelmintic agent that mainly acts by uncoupling oxidative phosphorylation in flukes. Oxyclozanide shows good anti-adenovirus, anti-biofilm, antifungal, and antibacterial activity[1][2][3].

• HY-N0105

  Rhein	Inhibitor	99.56%
  Rhein is an anthraquinone compound with anti-inflammatory, antioxidant, and anti-cancer effects[1].

• HY-123412

  FOL7185	Inhibitor
  FOL7185, an antibacterial agent, is a hit against IspD and IspE enzymes isolated from bacteria[1].

• HY-32264

  X-Neu5Ac sodium	Inhibitor	99.98%
  X-Neu5Ac (sodium) is a substrate for chromogenic assay of neuraminidase activity in bacterial expression systems; with a Km of 0.89 mM for neuraminidase.

• HY-N0565AS

  Doxycycline-d3 hydrochloride	Inhibitor
  Doxycycline-d3 hydrochloride is deuterium labeled Doxycycline (hydrochloride). Doxycycline hydrochloride, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline hydrochloride shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5][6].

• HY-N14301

  Aquayamycin	Inhibitor
  Aquayamycin is an angucycline antibiotic. Aquayamycin is active against Gram-positive bacteria, Ehrlich ascites carcinoma, and Yoshida rat sarcoma cells[1].

• HY-129914

  Cefcanel daloxate	Inhibitor
  Cefcanel daloxate (KY-109 (free base)) is an orally active cephalosporin prodrug against Gram-positive bacteria and Haemophilus influenzae. Cefcanel daloxate is promising for research of uremia[1].

• HY-Y0682AR

  Ethylenediaminetetraacetic acid disodium dihydrate (Standard)	Inhibitor
  Ethylenediaminetetraacetic acid (disodium dihydrate) (Standard) is the analytical standard of Ethylenediaminetetraacetic acid (disodium dihydrate). This product is intended for research and analytical applications. Ethylenediaminetetraacetic acid (EDTA) disodium dehydrate is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid disodium dehydrate has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid disodium dehydrate decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid disodium dehydrate can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid disodium dehydrate can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-14743A

  Golotimod TFA	Inhibitor
  Golotimod TFA (SCV 07 TFA), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod TFA (SCV 07 TFA) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod TFA (SCV 07 TFA) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2)[1][2][3].

• HY-118540

  Resazurin	Inhibitor
  Resazurin (Diazoresorcinol) is a water-soluble, non-toxic, stable, membrane-permeable blue non-fluorescent dye (faintly fluorescent). Resazurin is used as a redox indicator, can be reduced to pink, highly fluorescent Resorufin (Ex=530-560 nm, Em=590 nm) in living cells. Resazurin can be used for the detection of cell viability, toxicity, proliferation, migration and invasion in cells (human, plant and animal, bacterial and fungal)[1][2].

• HY-B2144E

  Chitosan (≥90% deacetylated, Low viscosity,<200mPa.s)	Inhibitor
  Chitosan (Deacetylated chitin) (≥90% deacetylated, Low viscosity,<200mPa.s) is a polysaccharide obtained by deacetylating chitin, and exhibits antimicrobial activity against various bacteria and fungi[1][2].

• HY-B0525A

  Carbenicillin disodium	Inhibitor
  Carbenicillin disodium (Sodium carbenicillin) is a broad-spectrum semi-synthetic penicillin antibiotic for gram-negative bacteria. Carbenicillin disodium can interfere the cell wall synthesis while displaying low toxicity to plant tissue[1].

• HY-B0535S1

  Ethambutol-d10	Inhibitor
  Ethambutol-d10 is the deuterium labeled Ethambutol. Ethambutol is a bacteriostatic antimycobacterial agent, which obstructs the formation of cell wall by inhibiting arabinosyl transferases.

• HY-105932

  Lexithromycin	Inhibitor
  Lexithromycin is an erythromycin A derivative, with antibacterial activity.

• HY-B1497

  Silver sulfadiazine	Inhibitor
  Silver sulfadiazine (AgSD), a sulfonamide antibiotic, effects a dual inhibitory action on bacterial growth by its sulfa moiety (SD-SDZ) that prevents bacterial folate absorption and subsequent DNA synthesis. The silver that is released from Silver sulfadiazine binds and disrupts the DNA structure, precluding bacterial DNA replication[1].

• HY-138179

  7-APRA	Inhibitor
  7-APRA is a semi-synthetic intermediate of cephalosporin antibiotics. 7-APRA has antibacterial activity and is mainly used in the synthesis of other Cefaclor (HY-B0198) and Cefprozil (HY-B0458A)[1].

• HY-P5486

  Tet-20	Inhibitor
  Tet-20 is a biological active peptide. (Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cells)

• HY-P1539A

  Cecropin A TFA	Inhibitor	99.00%
  Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory[1] and anti-cancer activity[2].

• HY-B1907

  Rifamycin sodium	Inhibitor	98.34%
  Rifamycin sodium (Rifamycin SV monosodium) belongs to the family of ansamycin antibiotics and has been isolated from the fermentation of A. mediterranei or its mutants. Rifamycin sodium displays a broad spectrum of antibiotic activity against Gram-positive and, to a lesser extent, Gram-negative bacteria[1].

• HY-100833

  Antibiotic-5d	Inhibitor	99.71%
  Antibiotic-5d is a synthesis and antimicrobial compound.

• HY-158425

  Antimicrobial agent-31	Inhibitor
  Antimicrobial agent-31 (compound 4a) is a potent antimicrobial agent. Antimicrobial agent-31 inhibits Salmonella enterica serovar Typhimurium and E.coli with MIC values of 19.24, 11.31 µg/mL, respectively[1].

• HY-N11506

  lsocryptomerin	Inhibitor
  lsocryptomerin is a membrane-active antifungal compound that can be isolated from Selaginella tamariscina. lsocryptomerin can depolarize fungal plasma membrane. lsocryptomerin also shows anticancer and antibacterial activities[1][2].

• HY-W004294

  1-Tetradecanol	Inhibitor	99.34%
  1-Tetradecanol is a straight-chain saturated fatty alcohol and antibacterial agent. 1-Tetradecanol can be isolated from Myristica fragrans. 1-Tetradecanol possesses antibacterial and anti-inflammatory (periodontitis) activity[1][2][3].

• HY-17586A

  Dalbavancin	Inhibitor
  Dalbavancin (MDL-63397) is a semisynthetic lipoglycopeptide antibiotic with potent bactericidal activity against Gram-positive bacteria. Dalbavancin inhibits Staphylococcus aureus and Bacillus anthracis with MIC90s of 0.06 μg/mL and 0.25 μg/mL, respectively[1][2].

• HY-B0956

  Paromomycin sulfate	Inhibitor	99.93%
  Paromomycin (Aminosidine) sulfate, a neomycin (HY-B0470) derivative, is a broad spectrum aminoglycoside antibiotic with amebicidal and bactericidal effects. Paromomycin sulfate prematures termination of translation of mRNA and inhibits protein synthesis by specifically binds to the RNA oligonucleotide at the A site of bacterial 30S ribosomes. Paromomycin sulfate can be used for the research of bacterial and parasitic infections[1][2][3].

• HY-147958

  Antibacterial agent 113	Inhibitor
  Antibacterial agent 113 (compound 3) is a potent antibacterial agent. Antibacterial agent 113 shows antibacterial activity against P.aeruginosa, S.mutans, B.subtilis, E.coli, E.faecalis, S.typhimuriumand, and S.aureus microorganisms, with MIC values all of 156.25 μM[1].

• HY-B0343C

  Sarafloxacin (hydrochloride) 100 μg/mL in methanol	Inhibitor
  Sarafloxacin hydrochloride 100 μg/mL in methanol is an antibiotic with activity to inhibit bacterial growth. Sarafloxacin hydrochloride 100 μg/mL in methanol is widely used in veterinary medicine to inhibit bacterial infections. The mechanism of action of Sarafloxacin hydrochloride 100 μg/mL in methanol is mainly achieved by inhibiting the activity of bacterial DNA gyrase. Sarafloxacin hydrochloride 100 μg/mL in methanol is also used in animal feed to improve feed conversion and promote growth.

• HY-115194

  Amastatin hydrochloride	Inhibitor	98%
  Amastatin hydrochloride is a slow, tight binding, competitive aminopeptidase (AP) inhibitor with Ki values of 0.26 nM, 30 nM, 52 nM for Aeromonas aminopeptidase, cytosolic leucine aminopeptidase, microsomal aminopeptidase[1].

• HY-N10907

  4(1H)-Quinolinone, 1-methyl-2-(5Z)-5-undecen-1-yl-	Inhibitor
  4(1H)-Quinolinone, 1-methyl-2-(5Z)-5-undecen-1-yl- (compound 2) is a quinolone alkaloid that can be isolated from Cnidium. 4(1H)-Quinolinone, 1-methyl-2-(5Z)-5-undecen-1-yl- has methicillin-resistant Staphylococcus aureus (MRSA) activity, with MIC values of 32 μg/mL (ATCC 33591) and 16 μM/mL (ATCC 25923), respectively[1].

• HY-13777R

  Zoledronic Acid (Standard)
  Zoledronic Acid (Standard) is the analytical standard of Zoledronic Acid. This product is intended for research and analytical applications. Zoledronic Acid (Zoledronate) is a third-generation bisphosphonate (BP), with potent anti-resorptive activity. Zoledronic Acid inhibits the differentiation and apoptosis of osteoclasts. Zoledronic Acid also has anti-cancer effects[1].

• HY-112579

  Ceftobiprole	Inhibitor
  Ceftobiprole (Ro 63-9141) is a broad-spectrum cephalosporin with high levels of in vitro activity against methicillin- (MRSA) and vancomycin-resistant staphylococci (VRSA) and penicillin-resistant streptococci with a MIC90 value of 2 μg/mL for MRSA. Ceftobiprole also inhibits gram-positive and gram-negative pathogens. Ceftobiprole can be used for the study of hospital-acquired pneumonia (excluding ventilator-associated pneumonia) and community-acquired pneumonia[1][2][3].

• HY-146549

  RmlA-IN-1
  RmlA-IN-1 (Compound 8a) is a potent inhibitor of glucose-1-phosphate thymidylyltransferase (RmlA) with an IC50 of 0.073 μM. RmlA-IN-1 influences monosaccharide l-Rhamnose biosynthetic pathway. RmlA-IN-1 affects bacterial cell wall permeability[1].

• HY-N7609

  Kipukasin D	Inhibitor
  Kipukasin D is an natural nucleoside derived from Aspergillus versicolor with antibacterial activity[1].

• HY-109124

  Taniborbactam	Inhibitor
  Taniborbactam (VNRX-5133) is a reversible and selective boronic acid-containing pan-spectrum β-lactamase inhibitor with IC50s of 8-530 nM. Taniborbactam has IC50s of 30 nM, 32 nM, 42 nM, 20 nM for KPC-2, AmpC, OXA-48, and VIM-2. Taniborbactam is against Gram-negative bacteria[1][2].

• HY-17628

  Cefiderocol	Inhibitor
  Cefiderocol (S-649266) is a siderophore cephalosporin which has a potent activity against a broad range of aerobic Gram-negative bacterial species with MIC50s of 2 μg/mL or less.

• HY-119839

  Acediasulfone	Inhibitor
  Acediasulfone is an antimicrobial. Acediasulfone can formation of a colored product reaction with p-dimethylaminobenzaldehyde[1].

• HY-N0716A

  Berberine hemisulfate	Inhibitor
  Berberine hemisulfate is the hemisulfate form of Berberine (HY-N0716). Berberine hemisulfate is an alkaloid isolated from the Chinese herbal medicine Huanglian. Berberine hemisulfate exhibits anti-inflammatory, antibiobic, antitumor, cardiovascular protective and neuroprotective activity[1][2][3][4][5][6].

• HY-B0274A

  Chlorprothixene hydrochloride	Inhibitor
  Chlorprothixene hydrochloride is a dopamine and histamine receptors antagonist with Kis of 18 nM, 2.96 nM, 4.56 nM, 9 nM and 3.75 nM for hD1, hD2, hD3, hD5 and hH1 receptors, respectively. Antipsychotic activity[1].

• HY-P10364

  Ubiquicidin(29-41)
  Ubiquicidin(29-41) is an antimicrobial peptide highly homologous to S30. Ubiquicidin(29-41) targets bacterial and fungal. Ubiquicidin(29-41) can be used as a membrane-specific infection localizer[1].

• HY-146057

  Antituberculosis agent-2	Inhibitor
  Antituberculosis agent-2 (Compound 8d) is an antituberculosis agent against agent-sensitive and multidrug-resistant tuberculosis. Antituberculosis agent-2 shows anti-tuberculosis activity with MIC values of 0.454, 1.757 and 1.644 μg/mL against M. tuberculosis H37Rv, 13946 and 14862, respectively. Antituberculosis agent-2 displays favorable mouse and human microsomal stability, low cytotoxicity, and acceptable oral bioavailability[1].

• HY-18715

  Ornidazole (Levo-)	Inhibitor	98.86%
  Ornidazole Levo- is the levo-isomer of Ornidazole. Ornidazole is a 5-nitroimidazole derivative with antiprotozoal and antibacterial properties against anaerobic bacteria. Ornidazole Levo- is the less active isomer.

• HY-136409

  N-Decanoyl-L-homoserine lactone	Inhibitor	99.43%
  N-decanoyl-L-homoserine lactone (C10-HSL) is a N-acyl-homoserine lactone (AHL) N-decanoyl-L-homoserine lactone can inhibit primary root growth in Arabidopsis. N-decanoyl-L-homoserine lactone triggers a transient and immediate increase in the concentrations of cytosolic free Ca2+ and reactive oxygen species (ROS), increases the activity of mitogen-activated protein kinase 6 (MPK6), and induces nitric oxide (NO) production in Arabidopsis roots[1].

• HY-P2076

  Dusquetide	Inhibitor	99.77%
  Dusquetide (SGX942) is a first-in-class innate defense regulator (IDR). Dusquetide modulates the innate immune response to both PAMPs and DAMPs by binding to p62. Dusquetide shows activity in both reducing inflammation and increasing clearance of bacterial infection[1]. DAMPs: damage-associated molecular patterns; PAMPs: pathogen-associated molecular patterns

• HY-129155

  (Rac)-Germacrene D
  (Rac)-Germacrene D is a natural product that can be isolated from the genus Bursera[1].

• HY-B1050R

  Gemifloxacin (mesylate) (Standard)	Inhibitor
  Gemifloxacin (mesylate) (Standard) is the analytical standard of Gemifloxacin (mesylate). This product is intended for research and analytical applications. Gemifloxacin mesylate (SB-265805S; LB-20304a) is an orally active broad-spectrum quinolone antibacterial antibiotic. Gemifloxacin mesylate inhibits DNA synthesis by inhibiting DNA gyrase and Topoisomerase IV activities. Gemifloxacin mesylate has potent antibacterial activities against gram-positive bacteria in vitro efficacy study, particularly Streptococci and Staphylococci. Gemifloxacin mesylate has been used in the research of respiratory tract infections[1][2][3].

• HY-123219

  Salifluor	Inhibitor
  Salifluor is a broad spectrum antimicrobial agent that has been investigated for its abilities to inhibit dental plaque formation. Salifluor can act as an effective anti-inflammatory agent[1].

• HY-N0349

  Methyl paraben	Inhibitor	99.86%
  Methyl Paraben is a standardized methyl paraben allergen isolated from Yunnan hemlock (Tsuga dumosa). Methyl Paraben is commonly used as a stable, non-volatile preservative. Methyl Paraben increases histamine release and cellular regulation of immunity, blocks sodium channels, and prevents ischemia-reperfusion injury[1][2][3][4].

• HY-B0323A

  Sulfisoxazole diethanolamine	Inhibitor
  Sulfisoxazole (Sulfafurazole) diethanolamine is an endothelin receptor antagonist with IC50 values of 0.60 μM and 22 μM against endothelin receptor A and endothelin receptor B, respectively. Sulfisoxazole diethanolamine is a sulfonamide antibacterial with an oxazole substituent. Sulfisoxazole diethanolamine inhibits breast cancer exosome release by targeting endothelin receptor A[1][2].

• HY-157044

  Antibacterial agent 162 trifluoromethanesulfonate	Inhibitor
  Antibacterial agent 162 trifluoromethanesulfonate (compound 7) is an antibacterial agent that exhibits potent inhibitory activity against Staphylococcus aureus, including MRSA. Antibacterial agent 162 trifluoromethanesulfonate is also an anticancer agent and exhibits antiproliferative activity against colon cancer and non-small cell lung cancer cells. Antibacterial agent 162 trifluoromethanesulfonate can be used in anticancer and antibacterial research[1].

• HY-76200R

  Voriconazole (Standard)
  Voriconazole (Standard) is the analytical standard of Voriconazole. This product is intended for research and analytical applications. Voriconazole (UK-109496) is a second-generation, broad-spectrum triazole antifungal agent that inhibits fungal ergosterol biosynthesis. Voriconazole exerts its antifungal activity by inhibition of 14-α-lanosterol demethylation, which is mediated by fungal cytochrome P450 enzymes[1][2].

• HY-B0975S

  Penicillin V-13C6 potassium	Inhibitor	99.8%
  Penicillin V-13C6 (potassium) is the 13C6 labeled Penicillin V (potassium). Penicillin V Potassium (Phenoxymethylpenicillin potassium salt) is an orally active antibiotic. Penicillin V Potassium inhibits the growth of Streptococci, C. difficile and S. aureus. Penicillin V Potassium can be used for the research of otitis, sinusitis, pharyngitis and tonsillitis.

• HY-B0509AR

  Amikacin (Standard)
  Amikacin (Standard) is the analytical standard of Amikacin. This product is intended for research and analytical applications. Amikacin (BAY 41-6551), a semisynthetic analog of kanamycin, is very active against most gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin (BAY 41-6551) is ototoxic and nephrotoxic[1][2].

• HY-169507

  Anthelvencin A	Inhibitor
  Anthelvencin A is a pyrrolamide metabolite with moderate antibacterial and anthelmintic activities[1].

• HY-128866

  TBAJ-876
  TBAJ-876 is the inhibitor of mycobacterium tuberculosis. TBAJ-876 is the analogue of the anti-tuberculosis agent Bedaquiline. TBAJ-876 has the potential for the research of tuberculosis[1].

• HY-124902

  Valclavam	Inhibitor
  Valclavam is an antibiotic, which exhibits antibacterial and antifungal activities. Valclavam inhibits homoserine-O-succinyltransferase (EC 2.3.1.46), blocks the methionine synthesis, and thus inhibits Escherichia coli. Valclavam inhibits Saccharomyces cerevisiae through inhibition of RNA formation. Valclavam inhibits the movement and reproduction of nematode Caenorhabditis elegans.

• HY-N2795

  9-Hydroxycalabaxanthone	Inhibitor	99.14%
  9-Hydroxycalabaxanthone (Xanthone I) is a known xanthone isolated from Garcinia mangostana Linn. 9-Hydroxycalabaxanthone has quorum-sensing inhibitory, anti-microbial, and anti-malarial activities (IC50=1.2-1.5 μM)[1].

• HY-164036

  Lolamicin	Inhibitor	98.02%
  Lolamicin is a Gram-negative specific antibiotic. Lolamicin is active against more than 130 multidrug-resistant clinical isolates, has shown efficacy in multiple mouse models of acute pneumonia and sepsis infection, and protects the gut microbiome of mice against secondary infection with Clostridium difficile. The selective killing of pathogenic gram-negative bacteria by Lolamicin is a result of the low sequence homology of pathogenic bacteria and symbiotic bacteria. Lolamicin can be used in the study of infection caused by Gram-negative pathogens[1].

• HY-P5604

  Maximin 1	Inhibitor
  Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect[1].

• HY-B0134

  Bestatin	Inhibitor
  Bestatin is a natural, broad-spectrum, and competitive CD13 (Aminopeptidase N)/APN and leukotriene A4 hydrolase inhibitor. Bestatin has anticancer effects[1][2].

• HY-A0162R

  Quinupristin (Standard)	Inhibitor
  Bictegravir (sodium) (Standard) is the analytical standard of Bictegravir (sodium). This product is intended for research and analytical applications. Bictegravir sodium is a potent inhibitor of HIV-1 integrase, with an IC50 of 7.5 nM. Bictegravir sodium exhibits potent and selective anti-HIV activity and low cytotoxicity[1].

• HY-113542

  Blasticidin A	Inhibitor
  Blasticidin A ((+)-Blasticidin A) is an inhibitor of Aflatoxin production by Aspergillus parasiticus. Blasticidin A almost completely inhibits Aflatoxin production at 0.5 μM[1]. Blasticidin A is a potent antibiotic produced by Streptomyces, inhibits Aflatoxin production without strong growth inhibition toward Aflatoxin-producing fungi[2].

• HY-15230R

  Geldanamycin (Standard)	Inhibitor
  Geldanamycin (Standard) is the analytical standard of Geldanamycin. This product is intended for research and analytical applications. Geldanamycin is a Hsp90 inhibitor with antimicrobial activity against many Gram-positive and some Gram-negative bacteria. Geldanamycin has anti-influenza virus H5N1 activities.

• HY-124138

  Pikromycin	Inhibitor
  Pikromycin is a macrolide antibiotic that has been found in S. venezuelae and active against E. coli, S. aureus and B. subtilis[1].

• HY-A0111B

  Cefetamet hydrochloride	Inhibitor
  Cefetamet (Ro 15-8074) hydrochloride, an active cephalosporin compound, possesses abroad spectrum of activity against many aerobic gram-positiveand-negativeorganisms[1].

• HY-N14922

  Nikkomycin Lx
  Nikkomycin Lx is an antibiotic that can be extracted from Streptomyces tendae TU901. Nikkomycin Lx exhibits anti-Candida Albicans activity and can be utilized in relevant research[1].

• HY-148851

  Bacteriochlorophyll a, from Rhodopseudomonas sphaeroides (under argon)	Inhibitor
  Bacteriochlorophyll a, from Rhodopseudomonas sphaeroides (under argon) (BChl a, from Rhodopseudomonas sphaeroides (under argon)) is a chlorophyll analog found in some bacteria that participates in the light absorption and energy transfer processes of photosynthesis[1].

• HY-P5713

  Des(8-14)brevinin-1PMa	Inhibitor
  Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity[1].

• HY-152137

  Antituberculosis agent-7	Inhibitor
  Antituberculosis agent-7, an oxetanyl-quinoline derivative, has shown good antibacterial activity against P. mirabilis with a MIC of 31.25 μM. Antituberculosis agent-7 shows good antifungal activity against A. niger with a MIC of 62.5 μM. Antituberculosis agent-7 shows excellent antimycobacterial activity with MIC 3.41 μM for M. tuberculosis H37Rv[1].

• HY-139836

  Antistaphylococcal agent 3	Inhibitor
  Antistaphylococcal agent 3 is an antistaphylococcal therapeutic agent.

• HY-B0395C

  Sitafloxacin hydrate	Inhibitor	99.89%
  Sitafloxacin (DU6859a) hydrate is an orally active fluoroquinolone antibiotic (antibiotic) with in vitro activity against a wide range of Gram-positive and -negative bacteria, including anaerobic bacteria, as well as atypical pathogens. Sitafloxacin is used in the study of respiratory tract infections and urinary tract infections[1][2][3][4].

• HY-125650

  Pseudouridimycin	Inhibitor
  Pseudouridimycin (PUM) is an antibiotic that selectively inhibits bacterial RNA polymerase (RNAP), with an IC50 of about 0.1 μM and a minimum inhibitory concentration (MIC) of 4 - 6 μg/mL. Pseudouridimycin is a C-nucleoside analogue that's effective against both Gram-negative and Gram-positive bacteria. Pseudouridimycin inhibits bacterial growth in vitro and shows activity in a mouse model of purulent streptococcal peritonitis[1][2].

• HY-105321A

  PBT 1033 hydrochloride
  PBT 1033 hydrochloride is an orally active copper/zinc ionophore. PBT 1033 hydrochloride restores cognition in mouse models of Alzheimer's disease (AD). PB 1033 also has antibacterial activity against Gram-positive bacteria[1][2].

• HY-125048

  Racemomycin B	Inhibitor
  Racemomycin B (229-B; Streptothricin D), the main component from Streptomyces lavendulae OP-2, is a streptothricin antibiotic containing three β-lysine groups. RM-B exhibits antimicrobial activity against plant pathogenic microorganisms and effectively inhibits the growth of Brassica rapa L. roots at 50 ppm. RM-B showed a minimum inhibitory concentration (MIC) of 0.4 μg/ml against Pseudomonas syringae pv. tabaci IFO-3508 and a MIC range of 0.1-2.0 μg/ml against six strains of Fusarium oxysporum, showing stronger antimicrobial activity than RM-A and RM-C. The biological activity of racemomycin compounds increases with the increase in the number of β-lysine groups.

• HY-B1256A

  Cefuroxime	Inhibitor
  Cefuroxime is an orally active second-generation cephalosporin antibiotic with increased stability to β-lactamase. Cefuroxime has a broad spectrum activity against Gram-positive and Gram-negative bacteria[1].

• HY-B0537A

  Pentamidine dihydrochloride	Inhibitor
  Pentamidine dihydrochloride (MP-601205 dihydrochloride) is an antimicrobial agent and interferes with DNA biosynthetics. Pentamidine dihydrochloride inhibits parasite Leishmania infantum with an IC50 of 2.5 μM. Pentamidine dihydrochloride is a potent and selective protein tyrosine phosphatases (PTPases) and phosphatase of regenerating liver (PRL) inhibitor. Pentamidine dihydrochloride has the potential for Gambian trypanosomiasis, antimony-resistant leishmaniasis, and Pneumocystis carinii pneumonia treatment. Antitumor and antibacterial activities[1][2][3][4].

• HY-B0295

  Chloroxine	Inhibitor	99.79%
  Chloroxine is one of the important 8-hydroxyquinoline derivative. Chloroxine has effective antibacterial, antifungal, antiprotozoal and antiamoebic activities, especially used in treating the intestinal amebiasis. Chloroxine is also used in the treatment of dandruff and seborrheic dermatitis of the scalp[1][2].

• HY-125859A

  Myeloperoxidase, human white blood cells	Inhibitor
  Myeloperoxidase, human white blood cells (MPO) is a peroxidase. In Myeloperoxidase, human white blood cells mediate oxidative stress by promoting the production of reactive oxygen species (ROS) and active nitrogen (RNS), regulating the polarization and inflammation-related signaling pathways of microglia and neutrophils. Myeloperoxidase, human white blood cells has antibacterial activity[1][2].

• HY-101128

  Bicyclomycin benzoate	Inhibitor
  Bicyclomycin benzoate is an antibiotic exhibiting activity against a broad spectrum of Gram-negative bacteria and against the Gram-positive bacterium.

• HY-B0200BR

  Cephalexin (monohydrate) (Standard)	Inhibitor
  Cephalexin (monohydrate) (Standard) is the analytical standard of Cephalexin (monohydrate). This product is intended for research and analytical applications. Cephalexin (Cefalexin) monohydrate is a potent, orally active new semisynthetic cephalosporin antibiotic with a broad antibacterial spectrum. Cephalexin (Cefalexin) monohydrate has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria. Cephalexin (Cefalexin) monohydrate targets penicillin-binding proteins (PBPs) to inhibit bacterial cell wall assembly. Cephalexin (Cefalexin) monohydrate is used for the research of pneumonia, strep throat, and bacterial endocarditis, et al[1][2].

• HY-101128R

  Bicyclomycin benzoate (Standard)	Inhibitor
  Ethaverine (hydrochloride) (Standard) is the analytical standard of Ethaverine (hydrochloride). This product is intended for research and analytical applications. Ethaverine hydrochloride, a derivative of papaverine, inhibits cardiac L-type calcium channel. Ethaverine hydrochloride is a peripheral vasodilator and antispasmodic agent. Ethaverine hydrochloride can be used for research of peripheral vascular disease[1][2][3].

• HY-168447

  D-PheTrAP	Inhibitor
  D-PheTrAP is a bisubstrate analog inhibitor of 1-Deoxy-d-xylulose 5-phosphate synthase (DXPS). D-PheTrAP inhibits Escherichia coli DXPS (EcDXPS) and Pseudomonas aeruginosa DXPS (PaDXPS) with IC50 values of 0.52 μM, 2.1 μM, 2.4 μM, and 1.7 μM for wild-type (WT) EcDXPS, EcA426E, WT PaDXPS, and PaE431A, respectively[1].

• HY-I0447A

  Sodium 4-aminosalicylate dihydrate	Inhibitor	99.95%
  Sodium 4-aminosalicylate (Sodium para-Aminosalicylic acid) dihydrate is para-aminosalicylic acid (PAS), a dihydrofolate reductase (DHFR) inhibitor and antituberculous agent. PAS is incorporated into the folate pathway via dihydropteroate synthase (DHPS) and dihydrofolate synthase (DHFS) to generate the hydroxydihydrofolate antimetabolite, which in turn inhibits DHFR enzyme activity[1][2][3].

• HY-138546

  Fmoc-Tpi-OH	Inhibitor	99.24%
  Fmoc-Tpi-OH is a biologically active amino acid that can be used to synthesize antimicrobial peptide mimetics[1].

• HY-13629S1

  Etoposide-13C,d3	Inhibitor
  Etoposide-13C,d3 is the 13C- and deuterium labeled Etoposide. Etoposide (VP-16; VP-16-213) is an anti-cancer chemotherapy agent. Etoposide inhibits topoisomerase II, thus stopping DNA replication. Etoposide induces cell cycle arrest, apoptosis and autophagy[1].

• HY-135319

  Strictinin	Inhibitor
  Strictinin is a phenolic compound isolated from Pu'er teas. Strictinin has potential antiviral, antibacterial and laxative activities. Strictinin occurs by accelerating intestinal transit rather than enhancing gastric emptying, increasing food intake, or inducing diarrhea in rats.

• HY-P9957

  Raxibacumab	Inhibitor	98.88%
  Raxibacumab (ABthrax) is a human IgG1 monoclonal antibody against Bacillus anthracis protective antigen (PA). Raxibacumab blocks the toxin’s deleterious effects by preventing binding of the protective antigen component of the anthrax toxin to its receptors in host cells, thereby blocking the toxin’s deleterious effects. Raxibacumab can be used for anti-anthrax research[1][2].

• HY-101730

  Antibacterial compound 2	Inhibitor
  Antibacterial compound 2 is a useful antibacterial agent extracted from patent US5652238, compound example 9.

• HY-19895

  DS-8587	Inhibitor
  DS-8587 is a new fluoroquinolone with significant antibacterial activity. The MIC value of DS-8587 against clinically isolated amoxicillin-resistant Bacillus strains is superior to ciprofloxacin and levofloxacin. The antibacterial activity of DS-8587 is less affected by adeA/adeB/adeC or abeM efflux pumps, and has more advantages than ciprofloxacin. DS-8587 has a lower single-step mutation frequency than ciprofloxacin. DS-8587 may be an effective drug for inhibiting amoxicillin-resistant Bacillus infections[1].

• HY-P1768

  Urechistachykinin I	Inhibitor
  Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect[1][2].

• HY-150002

  Antibacterial agent 115	Inhibitor
  Antibacterial agent 115 (Compound 10) is an orally active antibacterial and anti-inflammatory agent[1].

• HY-17591

  Penicillin G potassium	Inhibitor
  Penicillin G potassium is a fast-acting penicillin family antibiotic. Penicillin G potassium can be used for the research of bacterial infections that affect the blood, heart, lungs, joints, and genital areas[1][2].

• HY-N0328

  alpha-Mangostin	Inhibitor	99.31%
  alpha-Mangostin (α-Mangostin) is a dietary xanthone with broad biological activities, such as antioxidant, anti-allergic, antiviral, antibacterial, anti-inflammatory and anticancer effects. It is an inhibitor of mutant IDH1 (IDH1-R132H) with a Ki of 2.85 μM.

• HY-N0351

  p-Coumaric acid	Inhibitor	99.83%
  p-Coumaric acid (trans-4-Hydroxycinnamic acid) is an isomer of cinnamic acid with oral activity. p-Coumaric acid inhibits cell proliferation and promotes apoptosis. p-Coumaric acid has antibacterial, anti-inflammatory, antioxidant and anti-tumor activities[1][2][3][4].

• HY-113784R

  Thiocarlide (Standard)
  β-Cyclodextrin (Standard) is the analytical standard of β-Cyclodextrin. This product is intended for research and analytical applications. β-Cyclodextrin is a cyclic polysaccharide composed of seven units of glucose (α-D-glucopyranose) linked by α-(1,4) type bonds. β-Cyclodextrin has often been used to enhance the solubility of agents. β-Cyclodextrin has anti-influenza virus H1N1 activities.

• HY-N8139

  2-Amino-3-carboxy-1,4-naphthoquinone	Activator	99.56%
  2-Amino-3-carboxy-1,4-naphthoquinone is the electron transfer mediator. 2-Amino-3-carboxy-1,4-naphthoquinone changes glucose metabolism of the homofermentative lactic acid bacteria[1].

• HY-W777979

  Frutinone A	Inhibitor
  Frutinone A is a CYP1A2 inhibitor, possesses a chromonocoumarin structural scaffold. Frutinone A shows various biological activities, including antibacterial and antioxidant[1].

• HY-19827

  Aeroplysinin 1	Inhibitor
  Aeroplysinin 1 ((+)-Aeroplysinin-1), a secondary metabolite isolated from marine sponges, shows potent antibiotic effects on Gram-positive bacteria and exerts antiviral activity against HIV-1 (IC50=14.6 μM). Aeroplysinin 1 has anti-inflammatory, anti-angiogenic and anti-tumor activities. Aeroplysinin 1 induces apoptosis in endothelial cells[1][2].

• HY-B2144I

  Chitosan (≥90% deacetylated,viscosity 10 mPa.s)	Inhibitor
  Chitosan (Deacetylated chitin) (≥90% deacetylated,viscosity 10 mPa.s) is a polysaccharide obtained by deacetylating chitin, and exhibits antimicrobial activity against various bacteria and fungi. Chitosan (≥90% deacetylated,viscosity 10 mPa.s) can be used as a versatile biomaterial in drug delivery, tissue engineering, and wound healing[1][2][3].

• HY-N2048R

  2,2':5',2''-Terthiophene (Standard)	Inhibitor

• HY-N0576

  Solanesol	Inhibitor
  Solanesol is an aliphatic terpene alcohol mainly found in Solanaceous plants, with anti-inflammatory, neuroprotective, and antimicrobial activities[1].

• HY-N1306

  Sideroxylin	Inhibitor
  Sideroxylin is a C-methylated flavone isolated from Callistemon lanceolatus and exerts antimicrobial activity against Staphylococcus aureus. Sideroxylin inhibits ovarian cancer cell proliferation and induces apoptosis, causing DNA fragmentation, depolarization of the mitochondrial membrane, the generation of reactive oxygen species (ROS)[1].

• HY-159118

  PC-Qz1	Inhibitor
  PC-Qz1 is a mitochondrial NADH-ubiquinone oxidoreductase (complex I) inhibitor with an IC50 of 470 nM. PC-Qz1 has antibacterial activity[1].

• HY-161413

  Antibacterial agent 204	Inhibitor
  Antibacterial agent 204 (Compd P2-56-3) possesses potentiated Rifampin (RIF) activity against Acinetobacter baumannii and Klebsiella pneumoniae. Antibacterial agent 204 (Compd P2-56-3) disrupts the outer membrane of A. baumannii. T[1].

• HY-17460R

  Garenoxacin (Standard)	Inhibitor
  Garenoxacin (Standard) is the analytical standard of Garenoxacin. This product is intended for research and analytical applications. Garenoxacin (BMS284756) is an orally active quinolone antibiotic and has a broad spectrum of activity against a wide array of gram-positive and gram-negative bacteria, anaerobes, and fastidious organisms[1].

• HY-N7652

  Terminolic acid	Inhibitor	99.63%
  Terminolic acid is a pentacyclic triterpenoid glucoside isolated from Combretum racemosum. Terminolic acid can inhibit the pro-inflammatory cytokines by binding to receptor active site of IL-1β and IL-6, and enhance anti-inflammatory cytokines by binding to IL-4 receptor binding sites. Terminolic acid also exhibits moderate antibacterial activity[1][1].

• HY-P5484

  SMAP-18	Inhibitor
  SMAP-18 is a biological active peptide. (SMAP-18 is a 18-amino acid residue peptide amide which is a truncated form of SMAP-29. Sheep myeloid antimicrobial peptide-29 (SMAP-29) displays extremely high antimicrobial activity against Pseudomonas strains, other Gram-negative bacteria, and multidrug-resistant pathogens. SMAP-18 displays much higher cell selectivity as compared to parental SMAP-29 because of its decreased hemolytic activity and retained antimicrobial activity.)

• HY-107193

  Bacitracin	Inhibitor
  Bacitracin is a polypeptide antibiotic against staphylococcal and pathogenic protozoa infections. Bacitracin inhibits cell wall biosynthesis and permeability through binding to the undecaprenyl pyrophosphate. Bacitracin inhibits macromolecular synthesis. Bacitracin is also a protein disulfide isomerase (PDI) inhibitor[1][2][3].

• HY-136943

  K-41	Inhibitor
  K-41 is an orally active antibiotic. K-41 can be obtained from Streptomyces hygroscopicus. K-41 has antibacterial and antiplasmodial activity[1][2].

• HY-137956

  Previridicatumtoxin	Inhibitor
  Previridicatumtoxin is a fungal metabolite with antibacterial and anticancer activities. Previridicatumtoxin can be extracted from P. aethiopicum and utilized in research related to cancer as well as infections[1][2].

• HY-P5663

  Bombinin H-BO1	Inhibitor
  Bombinin H-BO1 is an antimicrobial peptide derived from toad Bombina orientalis skin secretions. Bombinin H-BO1 is active against Candida albicans, and the MIC value is 256 mg/L[1].

• HY-B1355

  Oxyphenbutazone monohydrate	Inhibitor
  Oxyphenbutazone monohydrate is a Phenylbutazone (HY-B0230) metabolite, with anti-inflammatory effect. Oxyphenbutazone monohydrate is an orally active non-selective COX inhibitor. Oxyphenbutazone monohydrate selectively kills non-replicating Mycobaterium tuberculosis[1][2].

• HY-N0113R

  Hordenine (Standard)	Inhibitor
  Hordenine (Standard) is the analytical standard of Hordenine. This product is intended for research and analytical applications. Hordenine, an alkaloid found in plants, inhibits melanogenesis by suppression of cyclic adenosine monophosphate (cAMP) production[1].

• HY-162171

  Antibacterial agent 179	Inhibitor
  Antibacterial agent 179 (Compound 23) is a potent antibacterial agent, which effectively kills both Gram-negative and Gram-positive bacteria. Antibacterial agent 179 shows potent in vivo antibacterial efficacy in murine corneal infection models caused by Staphylococcus aureus or Pseudomonas aeruginosa[1].

• HY-169510

  Aurachin C	Inhibitor
  Aurachin C is an isoprenoid quinoline alkaloid with antiplasmodial, antifungal and antibacterial effects. Aurachin C is a selective terminal oxidases inhibitor[1].

• HY-B2170B

  Octenidine (saccharin)	Inhibitor
  Octenidine saccharin is a potent antibacterial agent, possessing activity against multidrug-resistant Gram-negative pathogens. Octenidine saccharin can inhibit the expression of biofilm genes and destroy the formation of biofilms[1][3].

• HY-N7097

  Sulbenicillin disodium	Inhibitor
  Sulbenicillin disodium is the disodium salt of Sulbenicillin. Sulbenicillin is a Penicillin antibiotic with antibacterial activity against a number of mucoid and non-mucoid strains of Pseudomonas aeruginosa[1].

• HY-B0210R

  Cefoperazone (Standard)	Inhibitor
  Cefoperazone (Standard) is the analytical standard of Cefoperazone. This product is intended for research and analytical applications. Cefoperazone, a semisynthetic cephalosporin, has a broad spectrum of antibacterial activity[1].

• HY-130838

  JH-LPH-33	Inhibitor	98.29%
  JH-LPH-33, a sulfonyl piperazine analog, is a potent UDP-2,3-diacylglucosamine pyrophosphate hydrolase LpxH inhibitor. JH-LPH-33 displays outstanding antibiotic activity with a MIC value of 0.66 μg/mL[1].

• HY-B0706AR

  Flomoxef (sodium) (Standard)	Inhibitor
  Flomoxef (sodium) (Standard) is the analytical standard of Flomoxef (sodium). This product is intended for research and analytical applications. Flomoxef sodium is a oxacephem group antibiotic, with excellent activity against various Gram-positive bacteria[1][2].

• HY-14881B

  (Rac)-Bedaquiline	Control
  (Rac)-Bedaquiline is the racemate of Bedaquiline. Bedaquiline (TMC207) is a diarylquinoline agent and inhibits Mycobacterium tuberculosis (Mtb) F1FO-ATP synthase through targeting both the c- and the ε-subunit. Bedaquiline has uncoupler activity. Bedaquiline is used for the multi-agent resistant tuberculosis[1][2].

• HY-N8148

  Cassiaside B	Inhibitor
  Cassiaside B, a naphthopyrone, has potent antimicrobial activity[1].

• HY-B0113S1

  Omeprazole-d3-1	Inhibitor
  Omeprazole-d3-1 is the deuterium labeled Omeprazole. Omeprazole (H 16868), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM[1]. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria[2].Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[3].

• HY-161028

  Antibacterial agent 167	Inhibitor
  Antibacterial agent 167 (compound 13) is an inhibitor of pathogenic bacterial carbonic anhydrases. Antibacterial agent 167 inhibits the growth of N. gonorrhea strains at concentrations ranging from 16 to 64 µg/mL[1].

• HY-B0901R

  Bromperidol (Standard)	Inhibitor
  Bromperidol (Standard) is the analytical standard of Bromperidol. This product is intended for research and analytical applications. Bromperidol (R-11333) possesses antipsychotic activity, with a high affinity for central dopamine receptors D2. Bromperidol can kill Mycobacteria in a synergistic manner with Spectinomycin[1][2].

• HY-161312

  Antifungal agent 93	Inhibitor
  Antifungal agent 93 (compound 10) is a potent antifungal agent. Antifungal agent 93 shows antimicrobial activity[1].

• HY-B1071R

  Lasalocid (Standard)	Inhibitor
  Lasalocid (Standard) is the analytical standard of Lasalocid. This product is intended for research and analytical applications. Lasalocid (Lasalocid-A; Ionophore X-537A; Antibiotic X-537A) is an antibacterial and anticoccidial agent used in feed additives.

• HY-153626

  Chlamydia pneumoniae-IN-1	Inhibitor
  Chlamydia pneumoniae-IN-1 (compound 55), a benzimidazole, shows high activity against the bacterium. Chlamydia pneumoniae-IN-1 has 99% inhibition of C. pneumoniae Growth at 10 μM, and has 95% inhibition effect on the viability of the host cells at 10 μM. Chlamydia pneumoniae-IN-1 inhibits the growth of the CV-6 strain with a MIC of 12.6 μM. Chlamydia pneumoniae-IN-1 has antichlamydial efficiency[1].

• HY-P5636

  Bombinin-like peptide 7		99.08%
  Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis[1].

• HY-144729

  Antibacterial agent 82	Inhibitor
  Antibacterial agent 82 (compound 7p) is an antibacterial agent[1].

• HY-Y0272S

  Saccharin-d4	Inhibitor	99.00%
  Saccharin-d4 is the deuterium labeled Saccharin. Saccharin is an orally active, non-caloric artificial sweeteners (NAS). Saccharin has bacteriostatic and microbiome-modulating properties[1].

• HY-W272217R

  Octacosane (Standard)	Inhibitor
  Octacosane (Standard) is the analytical standard of Octacosane. This product is intended for research and analytical applications. Octacosane is an endogenous metabolite with antibacterial activity. Octacosane shows high cytotoxicity against murine melanoma B16F10-Nex2 cells besides inducing protection against a grafted subcutaneous melanoma. Octacosane has the larvicidal activity against mosquito Culex quinquefasciatus with the LC50 concentration of 7.2 mg/l[1][2][3].

• HY-N10834

  (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol
  (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol is an antibacterial compound. (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol can be isolated from the roots of Atractylodes japonica. (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol has anti-methicillin-resistant Staphylococcus aureus (MRSA) activity with MIC values of 4-32 μg/mL. (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol can be used for the research of bacterial infection[1]. (6E,12E)-Tetradecadiene-8,10-diyne-1,3-diol is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-P2302

  Defensin HNP-3 human	Inhibitor
  Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors[1][2].

• HY-P2323

  Lactoferricin B (4-14), bovine TFA	Inhibitor	99.07%
  Lactoferricin B (4-14), bovine (TFA), a peptide corresponding to residues 4-14 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms[1].

• HY-168630

  FtsZ-IN-11	Inhibitor
  FtsZ-IN-11 (compound B6) is a FtsZ inhibitor with the IC50 of 235 μM against XooFtsZ. FtsZ-IN-11 can interact with XooFtsZ and inhibit its GTPase activity, leading to bacterial cell elongation and even death[1].

• HY-170937

  Urease-IN-20	Inhibitor
  Urease-IN-20 (compound XBP2) is an inhibitor of Helicobacter pylori (H. pylori). Urease-IN-20 inhibits H. pylori with an IC50 of 0.14 μM. Urease-IN-20 reduces cell Apoptosis and decreases ROS and γH2AX in GES-1 cells infected with H. pylori. Urease-IN-20 exhibits significant gastric mucosal protective effects. Urease-IN-20 shows the potential for H. pylori research[1].

• HY-139805A

  Ticarcillin monosodium	Inhibitor
  Ticarcillin monosodium is a semisynthetic, extended-spectrum, carboxypenicillin antibacterial agent, and is active against gram-positive cocci, including streptococci and staphylococci. Ticarcillin monosodium is also effective against most gram-negative organisms, including Pseudomonas aeruginosa. Ticarcillin monosodium can be used in lower respiratory tract infections, skin and skin structure infections, urinary tract infections, and intraabdominal infections research[1][2][3].

• HY-76199

  trans-4-Hydroxycyclohexanecarboxylic acid	Inhibitor
  trans-4-Hydroxycyclohexanecarboxylic acid is a substrate for cyclohexanecarboxylic acid production. trans-4-Hydroxycyclohexanecarboxylic acid is the by-product of intestinal bacterial metabolism via urinary excretion[1].

• HY-163203

  DDC18-8A	Inhibitor
  DDC18-8A is an amphiphilic dendrimer that exhibits high antibacterial and antibiofilm efficacy[1].

• HY-W016477

  Phenazine	Inhibitor
  Phenazine is an electron shuttles, which modulates the redox state of cells and the downstream gene expression related to biofilm formation and bacterial survival. Phenazines is a biocontrol agents, which affects the growth of plants and induces the systemic resistance in plants[1].

• HY-N15184

  Benanomicin B	Inhibitor
  Benanomicin B (Pradimicin C) is an antifungal antibiotic that also has antibacterial activity against two Gram-positive bacteria: Micrococcus luteus and Corynebacterium bovis[1].

• HY-B0318A

  Metronidazole hydrochloride	Inhibitor
  Metronidazole hydrochloride (SC 326421) is an orally active nitroimidazole antibiotic, can be used to research anaerobic infections. Metronidazole hydrochloride can cross blood brain barrier and results inflammation and skeletal muscle contraction under long-term application[1][2][3][4].

• HY-B1350A

  Fusidic acid sodium salt	Inhibitor	99.64%
  Fusidic acid sodium salt is an orally available antibacterial agent that inhibits bacterial protein synthesis by preventing the release of translation elongation factor G (EF-G) from ribosomes. Fusidic acid sodium salt inhibits the inhibitory and activating effects of interleukins IL-1 and IL-6 on glucose-induced insulin production and exhibits antidiabetic effects in a rat model. Fusidic acid sodium salt improves the symptoms of colitis in rats and inhibits the growth of Toxoplasma gondii and Listeria monocytogenes EGD in vitro, but not in mice[1][2][3][4][5][6].

• HY-W016256

  L-Methioninamide hydrochloride	Inhibitor
  L-Methioninamide hydrochloride, a Methionine analogue, is Methionyl-tRNA synthetase inhibitor[1].

• HY-N7057

  Nonanoic acid	Inhibitor
  Nonanoic acid is a naturally-occurring saturated fatty acid with nine carbon atoms. Nonanoic acid significantly reduces bacterial translocation, enhances antibacterial activity, and remarkably increases the secretion of porcine β-defensins 1 (pBD-1) and pBD-2[1].

• HY-W701251

  Ethylparaben-d5	Inhibitor
  Ethylparaben-d5 (Ethyl parahydroxybenzoate-d5) is deuterium labeled Ethylparaben. Ethylparaben is the ethyl ester of paraben and is used as an antifungal preservative and food additive[1][2].

• HY-B1892R

  Cefazolin (Standard)	Inhibitor
  Cefazolin (Standard) is the analytical standard of Cefazolin. This product is intended for research and analytical applications. Cefazolin (Cephazolin) is a first-generation cephalosporin antibiotic and can be used in varieties of bacterial infections research[1]. Cefazolin has anti-inflammatory effect and can attenuate post-operative cognitive dysfunction (POCD)[2].

• HY-170401

  Antibacterial agent 260	Inhibitor
  Antibacterial agent 260 (Compound 4r) exhibits board-spectrum antibacterial activity, inhibits P. aeruginosa and S. aureus with MIC of 0.0076 μM. Antibacterial agent 260 acts as a herbicidal agent, that inhibits the root- and stem-growth of Raphanus sativus L. (radish seed)[1].

• HY-134602

  5'-Methoxynobiletin
  5'-Methoxynobiletin is a potent and orally active antinociceptive and anti-inflammatory agent. 5'-Methoxynobiletin is a polymethoxyflavone, that can be isolated from A. conyzoides[1][2].

• HY-167892

  DRF-8417	Inhibitor
  DRF-8417, an oxazolidinone antibiotic, is active against Gram-positive and fastidious Gram-negative bacteria. DRF 8417 exhibits potent activity against Gram-positive pathogens with MIC50 and MIC90 values ranging from 0.06 to 1 mg/L[1][2].

• HY-144659

  Metallo-β-lactamase-IN-5	Inhibitor
  Metallo-β-lactamase-IN-5 (compound 5c) is a potent metallo-β-lactamases (MBL) inhibitor. Metallo-β-lactamase-IN-5 shows inhibitory activity against MBLs NDM-1 and VIM-1. Metallo-β-lactamase-IN-5 inhibits HUVECs with an IC50 of 45 μg/mL. Metallo-β-lactamase-IN-5 plus Imipenem exhibits synergistic antimicrobial activity[1].

• HY-P10547

  Macropin	Inhibitor
  Macropin (MAC-1 peptide) is an antimicrobial peptide found in the venom of the solitary bee Macropis fulvipes. Macropin has antibacterial activity against both Gram-positive and Gram-negative bacteria, and also exhibits inhibitory activity against fungi and moderate hemolytic activity against human erythrocytes. Macropin can be used in research on anti-infective therapy[1].

• HY-14648R

  Dexamethasone (Standard)	Inhibitor
  Dexamethasone (Standard) is the analytical standard of Dexamethasone. This product is intended for research and analytical applications. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

• HY-B1148A

  Furaltadone	Inhibitor
  Furaltadone, a nitrofuran agent, has the potential for the study in infections of chickens with salmonella enteritidis. Furaltadone is inhibitory and bactericidal in vitro for staphylococci [1][2].

• HY-147349

  ANT3310 sodium	Inhibitor	99.54%
  ANT3310 sodium is a broad-spectrum covalent Serine β-Lactamase inhibitor, with IC50 values ranging from 1 nM to 175 nM (a panel of Serine β-Lactamase). ANT3310 sodium potentiates activity of β-lactam antibiotics against Carbapenem-Resistant Enterobacterales (CRE) and Acinetobacter baumannii (CRAB). ANT3310 sodium can be used in the research of bacterial infection[1][2].

• HY-151806

  HadAB-IN-1	Inhibitor
  HadAB-IN-1 is a potent HadAB inhibitor. HadAB-IN-1 inhibits HadAB enzyme complexes activity with an IC50 value of 0.03 μM. HadAB-IN-1 also affects mycolic acid biosynthesis in Mycobacterium tuberculosis (Mtb). HadAB-IN-1 can be used for the research of tuberculosis (TB)[1].

• HY-162804

  ATP synthase inhibitor 3
  ATP synthase inhibitor 3 (compound PT6) is an orally active inhibitor of mycobacterial F-ATP synthase (IC50=0.788 μM). ATP synthase inhibitor 3 inhibits the growth of Mycobacterium tuberculosis H37Rv strain (ATCC-27294) in vitro and depletes intracellular ATP levels at an IC50 value of 30μM[1].

• HY-N0447

  8-Gingerol	Inhibitor	99.82%
  8-Gingerol can be found in the rhizome of ginger (Z. officinale) and has oral bioactivity. It activates TRPV1, with an EC50 value of 5.0 µM. 8-Gingerol inhibits COX-2 and also suppresses the growth of H. pylori in vitro. Additionally, 8-Gingerol exhibits anticancer, antioxidant, and anti-inflammatory properties by inhibiting the epidermal growth factor receptor (EGFR) and modulating its downstream STAT3/ERK pathway to suppress the proliferation, migration, and invasion of colorectal cancer cells. 8-Gingerol also exerts immunosuppressive effects by inhibiting oxidative stress, inducing cell cycle arrest, promoting apoptosis, and regulating autophagy. Furthermore, 8-Gingerol has cardioprotective effects. 8-Gingerol is promising for research in the fields of cancer, infection, immunosuppression, and cardiovascular diseases.

• HY-N8393

  Ascr#18	Inhibitor
  Ascr#18, an ascaroside, is a hormone of nematodes. Ascr#18 is expressed during nematode development. Ascr#18 increases resistance in Arabidopsis, tomato, potato and barley to viral, bacterial, oomycete, fungal and nematode infections[1].

• HY-117175

  Pandamarilactonine A	Inhibitor
  Pandamarilactonine A converted from Norpandamarilactonine-A of (S)-prolinol[1].

• HY-A0294

  Ertapenem	Inhibitor
  Ertapenem (MK-0826) is a broad spectrum and long acting β-lactam antibiotic. Ertapenem has a broad-spectrum anti-anaerobic activity against a variety of anaerobes with a mode MIC of 0.12 μg/mL. Ertapenem can be used for the research of severe infections caused by bacteria in the skin, lungs, stomach, pelvis, and urinary tract[1][2].

• HY-B1455S

  Clindamycin-d3 hydrochloride	Inhibitor	99.62%
  Clindamycin-d3 (hydrochloride) is the deuterium labeled Clindamycin. Clindamycin is an orally active and broad-spectrum bacteriostatic lincosamide antibiotic. Clindamycin can inhibit bacterial protein synthesis, possessing the ability to suppress the expression of virulence factors in Staphylococcus aureus at sub-inhibitory concentrations (sub-MICs). Clindamycin resistance results from enzymatic methylation of the antibiotic binding site in the 50S ribosomal subunit (23S rRNA). Clindamycin decreases the production of Panton-Valentine leucocidin (PVL), toxic-shock-staphylococcal toxin (TSST-1) or alpha-haemolysin (Hla). Clindamycin also can be used for researching malaria[1][2].

• HY-B0141C

  Estradiol hemihydrate
  Estradiol (β-Estradiol) hemihydrate is a steroid hormone and the major female sex hormone. Estradiol (β-Estradiol) hemihydrate can up-regulate the expression of neural markers of human endometrial stem cells (hEnSCs) and promote their neural differentiation. Estradiol (β-Estradiol) hemihydrate can be used for the research of cancers, neurodegenerative diseases and neural tissue engineering[1][2].

• HY-B0712

  Ceftriaxone	Inhibitor	99.07%
  Ceftriaxone (Ro 13-9904 free acid) is a broad spectrum β-lactam third-generation cephalosporin antibiotic, which has good antibacterial activity against a variety of gram-negative and positive bacteria. Ceftriaxone is a covalent inhibitor of GSK3β with IC50 value of 0.78 μM. Ceftriaxone is an inhibitor of Aurora B. Ceftriaxone has anti-inflammatory, antitumor and antioxidant activities. Ceftriaxone can be used in the study of bacterial infections and meningitis[1][2][3][4][5][6][7].

• HY-N6949

  Juglone	Inhibitor	99.77%
  Juglone (5-hydroxy-1,4-naphthalenedione) is a yellow dye that can be extracted from Juglans regia. Juglone induces apoptosis through the mitochondrial pathway. Juglone has antibacterial and antitumor activity [1][2][3].

• HY-106101

  Echinomycin
  Echinomycin (Quinomycin A) is potent small-molecule and cell-permeable inhibitor of hypoxia-inducible factor-1 (HIF-1) DNA-binding activity. Echinomycin selectively inhibits the cancer stem cells (CSCs) with an IC50 of 29.4 pM[1][2].

• HY-106574A

  Ceftobiprole medocaril sodium	Inhibitor
  Ceftobiprole medocaril (BAL5788) sodium is the parenteral proagent of Ceftobiprole (HY-112579). Ceftobiprole is a parenteral pyrrolidinone cephalosporin. Ceftobiprole is a broad-spectrum cephalosporin with high levels of in vitro activity against methicillin- (MRSA) and vancomycin-resistant staphylococci (VRSA) and penicillin-resistant streptococci. Ceftobiprole also inhibits gram-positive and gram-negative pathogens[1][2].

• HY-N0626R

  Sorbic acid (Standard)	Inhibitor
  Sorbic acid (Standard) is the analytical standard of Sorbic acid. This product is intended for research and analytical applications. Sorbic acid is a highly efficient, and nonpoisonous?food preservative.?Sorbic acid generally is an effective inhibitor of most molds and yeasts and some bacteria[1].

• HY-N6686

  Virginiamycin M1	Inhibitor	99.50%
  Virginiamycin M1 (Pristinamycin IIA; Ostreogrycin A), produced by Streptomyces virginiae, is an polyunsaturated macrocyclic lactone antibiotic and acts as a component of Virginiamycin (HY-112665)[1]. Virginiamycin M1 alone is against Staphylococcus aureus with a MIC of 0.25 μg/mL.

• HY-B1729R

  Phenoxyethanol (Standard)	Inhibitor
  Phenoxyethanol (Standard) is the analytical standard of Phenoxyethanol. This product is intended for research and analytical applications. Phenoxyethanol has a broad spectrum of antimicrobial activity against various gram-negative and gram-positive bacteria. Phenoxyethanol is an uncouple agent in oxidative phosphorylation from respiration and competitively inhibits malate dehydrogenase. Phenoxyethanol is used as a preservative in cosmetic, vaccine, and textile, et al[1].

• HY-N2464R

  Maltotetraose (Standard)
  Maltotetraose (Standard) is the analytical standard of Maltotetraose. This product is intended for research and analytical applications. Maltotetraose can be used as a substrate for the enzyme-coupled determination of amylase activity in biological fluids.

• HY-N3848

  Ermanin	Inhibitor
  Ermanin is a flavonoid isolated from Tanacetum microphyllum. Ermanin potently inhibits iNOS, COX-2 activities, and inhibits platelet aggregation. Ermanin has anti-inflammatory, anti-tuberculous and anti-viral/bacterial properties[1][2].

• HY-P1720

  Telomycin	Inhibitor
  Telomycin is a calcium-dependent antibiotic, which can be produced by Streptomyces. Telomycin inhibits gram-positive bacteria, including multidrug-resistant (MDR) pathogens[1].

• HY-N0802

  Tenuigenin	Inhibitor	99.24%
  Tenuigenin is a major active component isolated from the root of the Chinese herb Polygala tenuifolia. Tenuigenin protects against S.aureus-induced pneumonia by inhibiting NF-κB activation. Tenuigenin has anti-inflammatory effect[1].

• HY-P2064

  Lariatin A	Inhibitor
  Lariatins is a novel anti-mycobacterial peptides with a lasso structure produced by Rhodococcus jostii K01-B0171[1].

• HY-B0455

  Lomefloxacin hydrochloride	Inhibitor	99.84%
  Lomefloxacin (SC47111A) hydrochloride is a broad-spectrum quinolone antibiotic, with antimicrobial activity. Lomefloxacin hydrochloride is used for the research of respiratory tract infections, genitourinary infections, gastrointestinal infections, ENT infections, etc.[1][2].

• HY-A0110A

  Cefotiam hexetil hydrochloride	Inhibitor
  Cefotiam hexetil hydrochloride (CTM-HE) is an oral third-generation cephalosporin, which is a proagent of cefotiam, but has no anti-bacterial property. Cefotiam is an antibiotic[1].

• HY-119974

  Caracemide	Inhibitor
  Caracemide (NSC-253272) inhibits the enzyme ribonucleotide reductase of Escherichia coli. Caracemide is a novel anticancer agent derived from a hydroxamic acid and has demonstrated to produce severe central nervous system (CNS) toxicity[1][2].

• HY-101479

  Iclaprim	Inhibitor	99.49%
  Iclaprim is a new selective bacterial Dihydrofolate inhibitor, which can inhibit the growth of S. aureus (MRSA) with an MIC90 of 0.06 μg/mL.

• HY-161802

  Antibacterial agent 228	Inhibitor
  Antibacterial agent 228 (Compound 8) inhibits the mycobacterial ribosome (IC50 for Mycobacterium smegmatis is 2.31 μM) and exhibits antibacterial activity against M. tuberculosis H37Rv (MIC=2 and 0.25 μg/mL for wildtype and Δ1258c mutant), M. abscessus ATCC 19977 (MIC=8 and 8 μg/mL for wildtype and Δ2780c mutant) and M. smegmatis (MIC=8 μg/mL)[1].

• HY-10122

  Silodosin		99.82%
  Silodosin (KAD 3213; KMD 3213) is a potent, selective and orally active α1A-adrenergic receptor (α1A-AR) blocker. Silodosin exhibits high affinity for α1A-AR (Ki=0.036 nM), over 162-fold and 50-fold than for α1B-AR and α1D-AR with Ki values of 21 nM and 2.0 nM, respectively. Silodosin is an effective and well-tolerated agent, it can be used for the investigation of LUTS/BPH[1][3].

• HY-112639

  Aristeromycin	Inhibitor	99.34%
  Aristeromycin, an adenosine analog, is an antibiotic and a potent S-adenosylhomocysteine hydrolase (AHCY) inhibitor[1][2].

• HY-P1934A

  Cyclo(L-Phe-L-Pro)	Inhibitor	99.91%
  Cyclo(L-Phe-L-Pro), isolated from Pseudomonas fluorescens and Pseudomonas alcaligenes cell-free culture supernatants is an antifungal cyclic dipeptide[1]. Cyclo(L-Phe-L-Pro) inhibits IFN-β production by interfering with retinoic-acid-inducible gene-I (RIG-I) activation[2]. Cyclo(L-Phe-L-Pro) exhibits free-radical scavenging activity with the IC50 of 24 µM in the DPPH assay[3].

• HY-B1431S

  Butylparaben-d4	Inhibitor	98.60%
  Butylparaben-d4 is the deuterium labeled Butylparaben. Butylparaben is an organic compound, has proven to be a highly successful antimicrobial preservative in cosmetics, also used in medication suspensions, and as a flavoring additive in food.

• HY-111532

  (3R,4R)-A2-32-01	Inhibitor	99.73%
  (3R,4R)-A2-32-01 (compound 24(R,R)), the (R,R)-enantiomer of A2-32-01, is a Staphylococcus aureus caseinolytic protease (SaClpP) inhibitor[1].

• HY-146702

  MtTMPK-IN-8	Inhibitor
  MtTMPK-IN-8 (compound 27) is a moderate M. tuberculosis thymidylate kinase (MtbTMPK) inhibitor. MtTMPK-IN-8 has sub-micromolar activity against mycobacteria (MICs = 0.78~9.4 μM) without significant cytotoxicity. MtTMPK-IN-8 can be used for researching tuberculosis[1].

• HY-B1048

  Pasiniazid	Inhibitor
  Pasiniazid is an anti-TB and anti-leprosy drug, used to treat various types of TB and leprosy.

• HY-A0251

  Cefpodoxime	Inhibitor	98.75%
  Cefpodoxime (Cefpodoxime acid) is a potent antibiotic active against gram-positive and gram-negative bacteria. Cefpodoxime inhibits the majority of cells in microbial populations. Cefpodoxime can be used for acute otitis media, sinusitis and tosillopharyngitis research[1][2].

• HY-B0035

  Sulfamethazine	Inhibitor	99.66%
  Sulfamethazine (Sulfadimidine) is an antimicrobial that is widely used to treat and prevent various animal diseases (such as gastrointestinal and respiratory tract infections). In China and the European Commission, the maximum residue level for Sulfamethazine in animal product is set at 100 μg/kg[1][2].

• HY-B1213S

  Trimipramine-d3 maleate	Inhibitor
  Trimipramine-d3 (maleate) is the deuterium labeled Trimipramine maleate. Trimipramine maleate is a 5-HT receptor antagonist, with pKis of 6.39, 8.10, 4.66 for 5-HT1C, 5-HT2 and 5-HT1A, respectively[1][2].

• HY-N2759

  7-O-Isopentenyl-γ-fagarine	Inhibitor
  7-O-Isopentenyl-γ-fagarine is an alkaloid that can be isolated from Peltostigma guatemalense. 7-O-Isopentenyl-γ-fagarine has antibacterial and antimalarial activities in vitro[1].

• HY-B0132S

  Norfloxacin-d5	Inhibitor	99.91%
  Norfloxacin-d5 is the deuterium labeled Norfloxacin. Norfloxacin is a broad-spectrum antibiotic that is active against both Gram-positive and Gram-negative bacteria, which functions by inhibiting DNA gyrase[1][2].

• HY-N13882

  Aldgamycin F	Inhibitor
  Aldgamycin F is a Aldgamycin derivative with antibacterial activities[1].

• HY-N11646

  Ganorbiformin B	Inhibitor
  Ganorbiformin B is a lanostane triterpenoid. Ganorbiformin B shares the same lanostane skeleton with known ganoderic acids. The C-3 epimer of ganoderic acid T exhibits potent antimycobacterial activity against Mycobacterium tuberculosis H37Ra[1].

• HY-170398

  ZG297	Inhibitor
  ZG297 is an agonist for Staphylococcus aureus ClpP (SaClpP ) with an EC50 of 0.26 μM. ZG297 degrades SaFtsZ, inhibits the bacterial cell division, thereby exhibiting antistaphylococcal activity, that inhibits S. aureus 8325-4 strains and MRSA strains with MIC of 0.063-256 μg/mL. ZG297 exhibits anti-infectious efficacy in mouse models[1].

• HY-P5572

  Aurein 2.5	Inhibitor
  Aurein 2.5 is an antibiotic antimicrobial peptide. Aurein 2.5 has antibacterial and antifungal activity[1][2]

• HY-B2174

  Ethacridine lactate	Inhibitor	99.68%
  Ethacridine lactate (Acrinol) is a widely used antiseptic and abortifacient. Ethacridine lactate is effective against Staphylococcus aureus and other gram-positive cocci. Ethacridine lactate is also a poly(ADP-ribose) glycohydrolase (PARG) inhibitor[1][2][3].

• HY-125117

  Simocyclinone D8	Inhibitor
  Simocyclinone D8 is an anthracycline antibiotic with antibacterial and antitumor activity against Gram-positive bacteria. Simocyclinone D8 inhibits DNA gyrase and thus has an inhibitory effect on a variety of tumor cell lines[1].

• HY-12687R

  Tizoxanide (Standard)	Inhibitor
  Tizoxanide (Standard) is the analytical standard of Tizoxanide. This product is intended for research and analytical applications. Tizoxanide (TIZ) is the active metabolite of Nitazoxanide, which is a thiazolide anti-infective compound against anaerobic bacteria, protozoa, and a range of viruses. Tizoxanide (TIZ) has anti-HIV-1 activities and potent inhibition of both HBV and HCV replication with values EC50 of 0.46μM and 0.15 μM, respectively. Tizoxanide also exerts anti-inflammatory effects by inhibiting the production of pro-inflammatory cytokines and suppressing of the activation of the NF-κB and the MAPK signaling pathways in LPS-treated macrophage cells[1][3][4][5].

• HY-119030

  Rubradirin	Inhibitor
  Rubradirin is a polypeptide synthesis inhibitor with significant antibacterial activity. It specifically targets the peptidyl site (P site) of the ribosome and interferes with the initiation of protein synthesis by preventing the binding of fMet-tRNAf (formylmethionyl transfer RNA) to the 30S ribosomal subunit and the complete 70S ribosome in an initiation factor-dependent manner. Additionally, it dissociates already formed initiation complexes, thereby exerting its antibacterial effect[1][2]。

• HY-N0565S3

  Doxycycline-13C,d3	Inhibitor
  Doxycycline-13C,d3 is 13C and deuterium labeled Doxycycline. Doxycycline, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5][6].

• HY-W039897R

  Methyl α-D-mannopyranoside (Standard)

• HY-B0510S2

  Trimethoprim-d3	Inhibitor	98.24%
  Trimethoprim-d3is the deuterium labeled Trimethoprim. Trimethoprim is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim has the potential for urinary tract infections, Shigellosis and Pneumocystis pneumonia treatment[1][2][3].

• HY-B0113S3

  Omeprazole-13C,d3	Inhibitor	98.00%
  Omeprazole-13C,d3 is a 13C-labeled and deuterium labeled Omeprazole. Omeprazole (H 16868), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM[1]. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria[2].Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[3].

• HY-W749867

  Ca(II)-EDTA disodium dihydrate
  CaⅡ-EDTA disodium dihydrate (Calcium disodium EDTA dihydrate) is an orally active metal chelating reagent, exhibits bactericidal activities against periodontal pathogens Aggregatibacter actinomycetemcomitans, Prevotella intermedia and Porphyromonas gingivalis[1]. CaⅡ-EDTA disodium dihydrate is effective chelating antidotes for lead- and cadmium poisoning[2][3].

• HY-157300

  Antifungal agent 88
  Antifungal agent 88 (compound 54) has antifungal potency with MIC values ranging from <0.125 μg/mL to 1 μg/mL[1].

• HY-121000

  Albocycline	Inhibitor
  Albocycline (Ingramycin) is a macrolide antibiotic, which exhibits antibacterial activities against methicillin-resistant Staphylococcus aureus (MRSA), Vancomycin (HY-B0671)-intermediate (VISA), and Vancomycin (HY-B0671)-resistant S. aureus (VRSA) strains with MICs ranging from 0.5 to 1.0 μg/mL. Albocycline exhibits no toxicity to human cells at concentration of ≤64 μg/mL[1].

• HY-14814AR

  Delafloxacin (meglumine) (Standard)	Inhibitor

• HY-162508

  KSK-104	Inhibitor
  KSK-104 has potent antibacterial activity against Mycobacterium tuberculosis (MIC=0.78 μM). The role of KSK-104 is mainly involved in the synthesis and recovery pathways of pyridoxal 5'-phosphate (PLP), PLP-dependent enzymes and oxidative stress networks. KSK-104, as a candidate molecule for novel anti-tuberculosis drugs, can be used to develop research against drug-resistant mycobacterium tuberculosis[1].

• HY-A0098

  Tunicamycin	Inhibitor
  Tunicamycin is a mixture of homologous nucleoside antibiotic that inhibits N-linked glycosylation and blocks GlcNAc phosphotransferase (GPT). Tunicamycin causes accumulation of unfolded proteins in cell endoplasmic reticulum (ER) and induces ER stress, and causes blocking of DNA synthesis and cell cycle arrest in G1 phase. Tunicamycin inhibits gram-positive bacteria, yeasts, fungi, and viruses and has anti-cancer activity[1][2][3].Tunicamycin increases exosome release in cervical cancer cells[4].

• HY-N13147

  Tetromycin C5	Inhibitor
  Tetromycin C5 is an antibiotic, that exhibits board-spectrum antibacterial activity against gram-positive bacteria and their drug-resistant bacteria[1].

• HY-B0821

  Pymetrozine	Inhibitor
  Pymetrozine is a feeding inhibitor of Homoptera, in preventing transmission of cauliflower mosaic caulimovirus by the aphid species Myzus persicae (Sulzer).

• HY-17504B

  Rosuvastatin Sodium		99.85%
  Rosuvastatin Sodium is a competitive HMG-CoA reductase (HMGCR) inhibitor, with an IC50 of 11 nM. Rosuvastatin Sodium potently blocks hERG current with an IC50 of 195 nM[2]. Rosuvastatin Sodium reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin Sodium effectively lowers low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels[1][2][3].

• HY-143232

  Antibacterial agent 73	Inhibitor
  Antibacterial agent 73 (compound 7a) is a potent antimicrobial agent. Antibacterial agent 73 exhibits very good antitubercular activity (MIC=0.65 µg/mL) against Mtb H37Rv. Antibacterial agent 73 shows good activity against fungal and bacterial. Antibacterial agent 73 also shows cytotoxicity in MCF-7 breast cancer cell lines, with IC50 of 8.20 μM[1].

• HY-112225

  Narasin sodium
  Narasin sodium is a cationic ionophore and coccidiostat agent. Narasin inhibits NF-κB signaling and induces tumor cells apoptosis. Narasin sodium has antimicrobial and anticancer activity[1].

• HY-119749

  Diazaborine	Inhibitor	98.01%
  Diazaborine is an inhibitor for enoyl-acyl carrier protein (enoyl ACP) in an NAD+-dependent manner. Diazaborine exhibits antibacterial activity, MIC for E. coli and K. pneumoniae is 25 and 3.12 μg/mL[1].

• HY-B1329

  Apramycin sulfate	Inhibitor
  Apramycin (EBL 1003) sulfate is an orally active, acidic pH tolerant and aminoglycoside-modifying-enzymes-tolerant aminoglycoside antibiotic which inhibits protein biosynthesis by targeting the bacterial ribosome. Apramycin sulfate is a potential anti-drug-resistance antibiotic[1][2][3].

• HY-163197

  JSF-2827	Inhibitor
  JSF-2827 is a benzothiophene with antibacterial activity against Enterococcus faecium[1].

• HY-151614

  Anti-infective agent 7	Inhibitor
  Anti-infective agent 7 is a potent anti-infectious agent. Anti-infective agent 7 has anti-infection activity against P. falciparum (IC50=2.5 μM) and M. tuberculosis (MIC=9 μM)[1].

• HY-100576

  NH125	Inhibitor
  NH125 is a potent and selective inhibitor of eukaryotic elongation factor 2 kinase (eEF-2K/CaMKIII), also can induce eEF2 phosphorylation, with an IC50 of 60 nM for eEF-2K[1][2].

• HY-W436428

  V-161	Inhibitor
  V-161 is the orally active inhibitor for Na+-V-ATPase with an IC50 of 144 nM. V-161 inhibits Enterococcus hirae and Vancomycin-resistant Enterococcus faecium (VRE) under alkaline condition with MIC of 4 µg/mL and 4 µg/mL. V-161 inhibits colonization of VRE in mouse small intestine[1].

• HY-149811

  AcrB-IN-3	Inhibitor
  Efflux pump-IN-3 is an AcrB efflux pump inhibitor, with ability to potentiate the effect of antibiotics. Efflux pump-IN-3 inhibits Nile Red (a known substrate of AcrB) efflux. Efflux pump-IN-3 does not disrupts the bacterial outer membrane nor display toxicity in a nematode model[1].

• HY-P5576

  Aurein 3.3	Inhibitor
  Aurein 3.3 is an antibiotic antimicrobial peptide. Aurein 3.3 also has anticancer activity[1].

• HY-152495

  MenA-IN-1	Inhibitor
  MenA IN-1 is an effective inhibitor of 1,4-dihydroxy-2-naphthoate isoprenyltransferase (MenA) from Mycobacterium tuberculosis (MTB) with an IC50 value of 13 µM and an GIC50 value of 8 µM. MenA IN-1 can be used to curb the continuous spread of tuberculosis[1].

• HY-A0071

  Tildipirosin	Inhibitor	99.81%
  Tildipirosin, a long-acting macrolide, has antibiotic activity.

• HY-100821

  2,4-Dihydroxyphenylacetylasparagine	Inhibitor
  2,4-Dihydroxyphenylacetylasparagine is a potent and selective antagonist of glutamate. 2,4-Dihydroxyphenylacetylasparagine inhibits glutamate binding to rat brain synaptic membranes[1].

• HY-N2805

  9-Oxonerolidol	Inhibitor
  9-Oxonerolidol is a farnesane-type sesquiterpenoid with anti-pathogens activity. 9-Oxonerolidol can be isolated from Chiliadenus lopadusanus. 9-Oxonerolidol acts as a post-infectional inhibitor from plants, and inhibits Gram+ and Gram? bacteria resistant to the antibiotic[1][2].

• HY-P2233

  Globomycin	Inhibitor
  Globomycin is a lipopeptide antibiotic and a signal peptidase II (LspA) inhibitor. Globomycin inhibits processing of the prolipoprotein by binding irreversibly to the peptidase. Globomycin has toxic for the mollicute Spiroplasma melliferum with a MIC in the range 6.25-12.5 μM[1][2].

• HY-B1327R

  Chlortetracycline (hydrochloride) (Standard)	Inhibitor
  Chlortetracycline (hydrochloride) (Standard) is the analytical standard of Chlortetracycline (hydrochloride). This product is intended for research and analytical applications. Chlortetracycline hydrochloride (7-Chlorotetracycline hydrochloride) is a specific and potent calcium ionophore antibiotic that inhibits the binding of aminoacyl-tRNA to ribosomes.

• HY-B0712S1

  Ceftriaxone-13C2,d3 triethylammonium salt	Inhibitor
  Ceftriaxone-13C2,d3 triethylammonium salt is 13C and deuterated labeled Ceftriaxone (HY-B0712). Ceftriaxone (Ro 13-9904 free acid) is a broad spectrum β-lactam third-generation cephalosporin antibiotic, which has good antibacterial activity against a variety of gram-negative and positive bacteria. Ceftriaxone is a covalent inhibitor of GSK3β with IC50 value of 0.78 mM. Ceftriaxone is an inhibitor of Aurora B. Ceftriaxone has anti-inflammatory, antitumor and antioxidant activities. Ceftriaxone can be used in the study of bacterial infections and meningitis[1][2][3][4][5][6][7].

• HY-W392026

  Polyhexamethyleneguanidine hydrochloride	Inhibitor
  Polyhexamethyleneguanidine (PHMGH) hydrochloride is a positively charged polymer with broad-spectrum antimicrobial activity. It exerts its antibacterial effects by binding to the cell membranes of bacteria and fungi, disrupting membrane integrity. Polyhexamethyleneguanidine hydrochloride can be applied in studies related to disinfection, water treatment, pesticides, and other fields[1][2]

• HY-N0570

  Hydroxytyrosol	Inhibitor	99.60%
  Hydroxytyrosol (DOPET) is a phenolic compound with anti-oxidant, anti-atherogenic, anti-thrombotic, antimicrobial, anti-inflammatory and anti-tumour effects[1][2].

• HY-B1290S3

  2-Phenylethanol-13C2	Inhibitor
  2-Phenylethanol-13C2 is 13C labeled β-Caryophyllene (HY-B1290). β-Caryophyllene is a CB2 receptor agonist.

• HY-108569

  nTZDpa	Inhibitor
  nTZDpa is an antibiotic. nTZDpa is a PPARG partial agonist. nTZDpa has antibacterial activity. nTZDpa is effective against growing and persistent Staphylococcus aureus by lipid bilayer disruption[1].

• HY-121071

  Ascamycin	Inhibitor
  Ascamycin is a 5'-O-sulfonamide ribonucleoside antibiotic produced by Streptomyces sp. JCM9888. Ascamycin has a selective antibacterial activity against Xanthomonas species with MIC values of 0.4 μg/mL, 12.5 μg/mL and 12.5 μg/mL for Xanthomonas citri, Xanthomonas oryzae and Mycobacterium phlei, respectively[1][2][3].

• HY-B1436S

  Nifuroxazide-d4	Inhibitor
  Nifuroxazide-d4 is the deuterium labeled Nifuroxazide. Nifuroxazide is an effective inhibitor of STAT3, also exerts potent anti-tumor and anti-metastasis activity.

• HY-B0965A

  Thioridazine	Inhibitor
  Thioridazine, an antagonist of the dopamine receptor D2 family proteins, exhibits potent anti-psychotic and anti-anxiety activities. Thioridazine is also a potent inhibitor of PI3K-Akt-mTOR signaling pathways with anti-angiogenic effect. Thioridazine shows antiproliferative and apoptosis induction effects in various types of cancer cells, with specificity on targeting cancer stem cells (CSCs)[1][2][3][4].

• HY-W654157

  Dicloxacillin-13C4 sodium hydrate	Inhibitor
  Dicloxacillin-13C4 sodium hydrate is the 13C-labeled Dicloxacillin Sodium hydrate (HY-B0977). Radioactive isotopes labeled compounds can be used in metabolic analysis, allowing the movement of individual atoms to be precisely tracked and quantified[1].

• HY-147000

  DNA Gyrase-IN-1	Inhibitor
  DNA Gyrase-IN-1 (compound 42) is a potent and selective DNA gyrase inhibitor with an IC50 value of 2.6 µM. DNA Gyrase-IN-1 has high inhibitory activity against Mycobacterium tuberculosis (Mtb) with MIC of 0.49 µM. DNA Gyrase-IN-1 can be used for researching tuberculosis[1].

• HY-125654

  Olanexidine	Inhibitor
  Olanexidine is an antibacterial agent. Olanexidine is active against a wide range of bacteria, imcluding both Gram-positive and Gram-negative bacteria Olanexidine is also an antiseptic. Olanexidine can be used in the research of infection and inflammation[1][2][3].

• HY-157808

  Antibacterial agent 185	Inhibitor
  Antibacterial agent 185 (compound IP-01) is a potent antibacterial agent. Antibacterial agent 185 inhibits filamentous temperature-sensitive mutant Z (FtsZ) polymerization and bundling by increasing GTP hydrolysis. Antibacterial agent 185 inhibits Streptococcus pneumoniae and shows narrow-spectrum activity[1].

• HY-N0540R

  Cynaroside (Standard)	Inhibitor
  Cynaroside (Standard) is the analytical standard of Cynaroside. This product is intended for research and analytical applications. Cynaroside (Luteolin 7-glucoside) is a flavonoid compound that exhibits anti-oxidative capabilities. Cynaroside is also a potent influenza RNA-dependent RNA polymerase inhibitor with an IC50 of 32 nM. Cynaroside also is a promising inhibitor for H2O2-induced apoptosis, has cytoprotection against oxidative stress-induced cardiovascular diseases. Cynaroside also has antibacterial, antifungal and anticancer activities, antioxidant and anti-inflammatory activities[1][3][4][5].

• HY-147777

  14α-Demethylase/DNA Gyrase-IN-2	Inhibitor
  14α-Demethylase/DNA Gyrase-IN-2 (Compound 6a) is a potent inhibitor of 14α-Demethylase/DNA Gyrase. 14α-Demethylase/DNA Gyrase-IN-2 has antimicrobial activities[1].

• HY-B1906

  Streptomycin	Inhibitor
  Streptomycin (Agrept) is an effective antibiotic against M. tuberculosis, is used for the research of tuberculosis (TB). Streptomycin also is a bacteriocidal agent that can be used for the research of a number of bacterial infections. Streptomycin can bind strongly to nucleic acids, interferes and blocks protein synthesis while permitting continued RNA and DNA synthesis. Streptomycin, as a common antibiotic used in culture media, also is a blocker of stretch-activated and mechanosensitive ion channels in neurons and cardiac myocytes [1][2][3].

• HY-B2060

  Tiamulin	Inhibitor
  Tiamulin (Thiamutilin) is a diterpenic antibiotic that is widely used in pigs and poultry for the control of infectious diseases. Tiamulin is effectively used in the study of airsacculitis, which is primarily caused by Mycoplasma spp[1].

• HY-146301

  Mt KARI-IN-5	Inhibitor
  Mt KARI-IN-5 (compound 6c) is a potent Mycobacterium tuberculosis ketol-acid reductoisomerase (Mtb KARI) inhibitor with a Ki value of 4.72 μM. Mt KARI-IN-5 has inhibitory activity against Mtb H37Rv (MIC = 1.56 μM) and low cytotoxicity (HEK IC50 > 64 μg/mL)[1]

• HY-16742C

  Gepotidacin hydrochloride	Inhibitor
  Gepotidacin hydrochloride is a novel triazaacenaphthylene bacterial type II topoisomerase inhibitor.

• HY-B0502R

  Enrofloxacin (Standard)	Inhibitor
  Enrofloxacin (Standard) is the analytical standard of Enrofloxacin. This product is intended for research and analytical applications. Enrofloxacin (BAY Vp 2674) is an effective antibiotic with an MIC90 of 0.312 μg/mL for Mycoplasma bovis.

• HY-A0107

  Tetracycline	Inhibitor
  Tetracycline is a broad-spectrum antibiotic with oral activity. Tetracycline exhibits activity against a wide range of bacteria including gram-positive, gram-negative bacteria, chlamydiae, mycoplasmas and rickettsiae. Tetracycline can be used for the research of infections[1].

• HY-N8186

  (3R)-7,4’-Dihydrohomoisoflavanone	Inhibitor
  (3R)-7,4’-Dihydrohomoisoflavanone is a natural product with antibacterial activities against S. aureus and methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-163505

  Anti-MRSA agent 11	Inhibitor
  Anti-MRSA agent 11 suppresses fluoroquinolone-sensitive strain USA500 and -resistant MRSA isolate Mu50 (MIC =0.39 μg/mL). Anti-MRSA agent 11 displayes favorable in vivo half-life and safety profiles[1].

• HY-19487A

  Ribocil B	Inhibitor
  Ribocil-B is the active S-isomer of ribocil which can inhibit flavin mononucleotide (FMN) with a KD of 6.6 nM.

• HY-N12326

  Multiflorin A	Inhibitor
  Multiflorin A is an active ingredient derived from Pruni semen. Multiflorin A has laxative activity. Multiflorin A inhibits intestinal glucose absorption and promotes bacterial metabolism[1].

• HY-P5662

  Brevinin-2EC
  Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta[1].

• HY-149330

  HA5	Inhibitor
  HA5 inhibits Streptococcus mutans biofilm with an IC50 value of 6.42 μM, without affecting its growth. HA5 also inhibits Streptococcus mutans glucan production and eDNA levels[1].

• HY-B0502S

  Enrofloxacin-d5	Inhibitor	99.82%
  Enrofloxacin-d5 is the deuterium labeled Enrofloxacin. Enrofloxacin (BAY Vp 2674) is an effective antibiotic with an MIC90 of 0.312 μg/mL for Mycoplasma bovis.

• HY-N1944A

  cis-Nerolidol	Inhibitor
  cis-Nerolidol is a sesquiterpene alcohol that can be found in various plants. cis-Nerolidol exhibits antioxidant and antibacterial activities. cis-Nerolidol can also potentiate the action of antibiotics[1].

• HY-W016491R

  Isopropyl 4-hydroxybenzoate (Standard)	Inhibitor
  Isopropyl 4-hydroxybenzoate (Standard) is the analytical standard of Isopropyl 4-hydroxybenzoate. This product is intended for research and analytical applications. Isopropyl 4-hydroxybenzoate (Isopropylparaben) is an antimicrobial and antioxidant agent[1].

• HY-B1455S1

  Clindamycin-13C,d3	Inhibitor
  Clindamycin-13C,d3 is the 13C- and deuterium labeled Clindamycin. Clindamycin is an orally active and broad-spectrum bacteriostatic lincosamide antibiotic. Clindamycin can inhibit bacterial protein synthesis, possessing the ability to suppress the expression of virulence factors in Staphylococcus aureus at sub-inhibitory concentrations (sub-MICs). Clindamycin resistance results from enzymatic methylation of the antibiotic binding site in the 50S ribosomal subunit (23S rRNA). Clindamycin decreases the production of Panton-Valentine leucocidin (PVL), toxic-shock-staphylococcal toxin (TSST-1) or alpha-haemolysin (Hla). Clindamycin also can be used for researching malaria[1][2][3].

• HY-B0396R

  Tebipenem pivoxil (Standard)	Inhibitor

• HY-B1924R

  Norvancomycin (hydrochloride) (Standard)	Inhibitor
  Norvancomycin (hydrochloride) (Standard) is the analytical standard of Norvancomycin (hydrochloride). This product is intended for research and analytical applications. Norvancomycin hydrochloride is suitable for endocarditis, osteomyelitis, pneumonia, sepsis or soft tissue infections caused by Staphylococcus aureus (including methicillin-resistant strains and multi-drug-resistant strains).

• HY-113834

  (R,R)-Ethambutol	Inhibitor
  (R,R)-Ethambutol is an antituberculosis compound with tuberculosis inhibitory activity. (R,R)-Ethambutol is often used in combination with other antituberculosis compounds to enhance the efficacy. (R,R)-Ethambutol can also be used to inhibit Mycobacterium avium complex infection and Mycobacterium kansasii infection[1].

• HY-136502

  (E)-Aztreonam	Inhibitor
  (E)-Aztreonam (SQ-28429) is a monocyclic beta-lactam antibiotic. (E)-Aztreonam has the potential for the research of infections caused by gram-negative pathogens[1][2][3].

• HY-P5623B

  RVG TFA	Inhibitor	98.25%
  RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells[1].

• HY-120809

  Spiramycin III	Inhibitor
  Spiramycin III (SPMIII) is a main component of Spiramycin. Spiramycin (HY-100593) is a macrolide antibiotic produced by Streptomyces ambofaciens with against bacteria and Toxoplasma gondii activities, and also has antiparasitic effect[1][2].

• HY-N13892

  Alisamycin	Inhibitor
  Alisamycin is the manumycin group of antibiotic. Alisamycin is active against Gram-positive bacteria and fungi, and has a weak antitumour activity[1].

• HY-116282J

  Dextran sulfate, low sulfate (MW 5000)
  Dextran sulfate, low sulfate (MW 5000), a biopolymer, is a sulfated polysaccharide. Dextran sulfate, low sulfate (MW 5000) has antiviral, antibacterial, anti-inflammatory, antifibrotic, and wound-healing properties. Dextran sulfate can be used as an additive in cell culture media for preventing cell aggregation and in cosmetics as a gel-forming agent[1].

• HY-W408239

  N-Pentadecanoyl-L-homoserine lactone
  N-pentadecanoyl-L-Homoserine lactone is an N-acyl Homoserine lactone compound. N-pentadecanoyl-L-Homoserine lactone is a sensing molecule for bacterial populations[1].

• HY-B0996

  Hexetidine	Inhibitor
  Hexetidine (NSC-17764) is an orally active antibacterial and antifungal agent with broad antibacterial and antifungal activity. Hexetidine combined with IPBC potentiates strong fungal growth inhibition properties. Hexetidine at concentrations greater than 0.1% can cause oral ulceration. Additionally, Hexetidine improves its plaque inhibiting activities combined with zinc and has been confirmed the effectiveness on purulent wound along with ultrasound. Hexetidine is a promising candidate for research in fungus-related diseases and soft tissue purulent-inflammatory[1][2][3][4][5]

• HY-B0271S1

  Pyrazinamide-13C,15N	Inhibitor
  Pyrazinamide-13C,15N is 15N and 13C labeled Pyrazinamide (HY-B0271). Pyrazinamide (Pyrazinecarboxamide; Pyrazinoic acid amide) is a potent and orally active antitubercular antibiotic. Pyrazinamide is a proagent that is converted to the active form pyrazinoic acid (POA) by PZase/nicotinamidase encoded by the pncA gene in M. tuberculosis.

• HY-112589

  BRITE-338733	Inhibitor	98.04%
  BRITE-338733 is a RecA ATPase inhibitor, with an IC50 of 4.7 µM[1].

• HY-136613

  Demethyl linezolid	Inhibitor
  Demethyl linezolid is a impurity of linezolid. Demethyl linezolid is a useful antimicrobial agent extracted from patent WO1995007271A1, example 9, effective against a number of human and veterinary pathogens[1].

• HY-U00380

  Tigemonam	Inhibitor
  Tigemonam is a monobactam, with potent activity against Gram-negative aerobic bacterial pathogens.

• HY-W009156

  Citric acid tripotassium hydrate	Inhibitor
  Hydroxycitric acid tripotassium hydrate (Potassium citrate monohydrate) is the major active ingredient of Garcinia cambogia. Hydroxycitric acid tripotassium hydrate competitively inhibits ATP citrate lyase with weight loss benefits. Hydroxycitric acid tripotassium hydrate effective inhibits stones formation and also inhibits HIF, and has antioxidation, anti-inflammation and anti-tumor effects[1][2][3][4].

• HY-P1612

  Hormaomycin	Inhibitor
  Hormaomycin is a potent and selective macrocyc antibiotic agent. Hormaomycin has broad-spectrum antibiotic activity against numerous Gram-positive[1].

• HY-100007R

  Vonoprazan (Standard)	Inhibitor
  Vonoprazan (Standard) is the analytical standard of Vonoprazan. This product is intended for research and analytical applications. Vonoprazan (TAK-438 free base), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan inhibits H+,K+-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease. Vonoprazan can be used for eradication of Helicobacter pylori[1][2][3].

• HY-107329

  Cefathiamidine	Inhibitor
  Cefathiamidine is a first-generation cephalosporin antibacterial agent and is used to treat infections caused by susceptible bacteria. Cefathiamidine exhibits a wide spectrum of antimicrobial activity against bacteria. Cefathiamidine is used for the treatment of respiratory, liver, five senses, urinary tract infections, endocarditis and sepsis[1][2].

• HY-168466

  Anti-neuroinflammation agent 2	Inhibitor
  Anti-neuroinflammation agent 2 (compound 4) demonstrates anti-neuroinflammatory and antibacterial activities, with IC50 values of 3.06 µM for TNF-α and 4.31 µM for IL-6, alongside EC50 values ranging from 0.87 to 3.16 µM against Gram-positive bacteria[1].

• HY-B0536R

  Clinafloxacin (Standard)	Inhibitor
  Clinafloxacin (Standard) is the analytical standard of Clinafloxacin. This product is intended for research and analytical applications. Clinafloxacin (AM 1091) is a potent and broad-spectrum fluoroquinolone antibiotic, has inhibitory activity against gram-positive, gram-negative bacterias, and anaerobic pathogens in vitro[1]. Clinafloxacin is against DNA gyrase and topoisomerase IV of S. aureus with IC50 values of 0.92 µg/ml and 1.62 µg/ml, respectively[2].

• HY-N2214

  7-O-Methylaloeresin A	Inhibitor
  7-O-Methylaloeresin A is 5-methylchromone glycoside isolated from Commiphora socotrana (Burseraceae). 7-O-Methylaloeresin A exhibits good activity against multiple agent resistant Staphylococcus aureus (NCTC 11994) and Salmonella typhimurium (ATCC 1255) with MIC values of 0.72 and 0.18 mM, respectively. 7-O-Methylaloeresin A has antioxidant activities, gives IC50 values of 0.026 mM and 0.021 mM for DPPH and 2-deoxyribose degradation assay, respectively.

• HY-B0522S

  Ampicillin-d5	Inhibitor
  Ampicillin-d5 is the deuterium labeled Ampicillin. Ampicillin is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria[1][2][3].

• HY-14879B

  Avibactam sodium hydrate	Inhibitor	99.95%
  Avibactam sodium (NXL-104) hydrate is a covalent and reversible non-β-lactam β-lactamase inhibitor which inhibits β-lactamase TEM-1 and CTX-M-15 with IC50s of 8 nM and 5 nM, respectively[1].

• HY-135901

  Py-MPB-amino-C3-PBD	Inhibitor
  Py-MPB-amino-C3-PBD is a cytotoxic agent comprised non-alkylating group. Py-MPB-amino-C3-PBD acts as the payload for ADCs. Antimicrobial activity[1].

• HY-P1068A

  Recombinant human lysozyme (plant expression)	Inhibitor
  Recombinant human lysozyme (plant expression) is a conserved anti-bacterial protein that causes bacterial lysis and death by hydrolyzing bacterial cell wall peptidoglycan (PG). Recombinant human lysozyme (plant expression) can be used to study bacterial infections[1][2].

• HY-N12933

  11-Octadecenal
  11-Octadecenal is a volatile oil isolated from antibacterial components of coumarin, which can be isolated from synthetic insect sex pheromones used for attracting wax moths (Achroia grisella)[1][2].

• HY-113578

  PD 116152	Inhibitor
  PD 116152 is a phenazine Antibiotic with antimicrobial and antitumor activity. PD 116152 possesses cytotoxic activity against L1210 lymphocytic leukemia and human colon adenocarcinoma (HCT-8) cells with IC50 values of 5.2 x 10-7 M and 7.1 x 10-7 M, respectively. PD 116152 is promising for research of P388 lymphocytic leukemia[1][2].

• HY-B0616R

  Cefepime (Dihydrochloride Monohydrate) (Standard)	Inhibitor
  Cefepime (Dihydrochloride Monohydrate) (Standard) is the analytical standard of Cefepime (Dihydrochloride Monohydrate). This product is intended for research and analytical applications. Cefepime Dihydrochloride Monohydrate is a broad-spectrum cephalosporin with enhanced coverage against Gram-positive and Gram-negative bacteria[1].

• HY-N7632

  5-Desmethylsinensetin	Inhibitor	99.21%
  5-desmethylsinensetin, isolated from Artemisia princeps , possesses antiprotozoal activity. 5-desmethylsinensetin shows IC50 values of 0.4 μg/mL on T. cruzi epimastigotes and 75.1 μg/mL on trypomastigotes, respectively[1].

• HY-A0088AR

  Cefotaxime (Standard)	Inhibitor
  Cefotaxime (Standard) is the analytical standard of Cefotaxime. This product is intended for research and analytical applications. Cefotaxime, a β-lactamase stable cephalosporin and a third-generation cephalosporin antibiotic, possesses broad-spectrum antibiotic activity against numerous Gram-positive and Gram-negative bacteria[1][2][3][4][2].

• HY-W089538

  2-Ethyl-6-methylphenol	Inhibitor	98.79%
  2-Ethyl-6-methylphenol, an alkylphenol, is isolated form the tumorigenic neutral subfraction of cigarette smoke condensate. 2-Ethyl-6-methylphenol exhibits insecticidal and bactericidal activities[1][2].

• HY-17593R

  Solithromycin (Standard)	Inhibitor
  Solithromycin (Standard) is the analytical standard of Solithromycin. This product is intended for research and analytical applications. Solithromycin (CEM-101) is an orally bioavailable, effective antimicrobial agent, with IC50s for inhibition of cell viability, protein synthesis, and growth rate are 7.5 ng/mL, 40 ng/mL, and 125 ng/mL for Streptococcus pneumonia, Staphylococcus aureus, and Haemophilus influenzae, respectively. Solithromycin binds to the large 50S subunit of the ribosome and inhibits protein biosynthesis[1].

• HY-N3549

  Catalpin
  Catalpin is an iridoid that can be isoalted from Catalpae Fructus.Catalpin shows mutagenic activity towards Salmonella typhimurium strain TA100[1].

• HY-N13884

  Amythiamicin D	Inhibitor
  Amythiamicin D is a thiopeptide antibiotic that inhibits the growth of many Gram-positive bacteria, but not Gram-negative bacteria such as E.coli[1].

• HY-B1782

  Sulfamoxole	Inhibitor	99.73%
  Sulfamoxole is a broad- spectrum chemotherapeutic antimicrobial agent. Sulfamoxole can be used for the study of pediatric infections[1].

• HY-P3365

  Cecropin D	Inhibitor
  Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory[1][2].

• HY-B2237A

  Lysozyme chloride	Inhibitor
  Lysozyme chloride is a bactericidal enzyme, and it lyses gram-positive bacteria. Lysozyme chloride can also be used for the research of HIV infection and pulmonary emphysema[1][2][3].

• HY-W089856

  Chlorobutanol hemihydrate	Inhibitor
  Chlorobutanol hemihydrate is an antimicrobial agent with oral activity, also possessing preservative effects. Chlorobutanol hemihydrate exhibits resistance to a variety of Gram-positive and Gram-negative bacteria, as well as several fungal spores and fungi, and is widely used in the food and cosmetics industries[1][2][3][4][5].

• HY-Y0532

  N-Chlorosuccinimide	Inhibitor
  N-Chlorosuccinimide can enhance the antimicrobial effect of Benzalkonium chloride (HY-B2232) on biofilm Pseudomonas aeruginosa[1].

• HY-126131

  anti-TB agent 1	Inhibitor
  anti-TB agent 1 is a potent and orally active anti-tuberculosis agent, with MICs of < 2 nM against the Mtb strains H37Rv, rRMP and rINH[1].

• HY-B1257R

  Cefmetazole (sodium) (Standard)	Inhibitor
  Cefmetazole (sodium) (Standard) is the analytical standard of Cefmetazole (sodium). This product is intended for research and analytical applications. Cefmetazole sodium (Sodium cefmetazole) is a semisynthetic cephamycin antibiotic with broad-spectrum antibacterial activity, covering gram-positive, gram-negative, and anaerobic bacteria. Cefmetazole sodium binds to penicillin binding proteins (PBPs), resulting in interfering bacterial cell wall biosynthesis. Cefmetazole sodium is used for the research of gynecologic, intraabdominal, urinary tract, respiratory tract and skin and soft tissue infections[1][2][3].

• HY-100593R

  Spiramycin (Standard)	Inhibitor
  Spiramycin (Standard) is the analytical standard of Spiramycin. This product is intended for research and analytical applications. Spiramycin (Rovamycin) is a macrolide antibiotic produced by Streptomyces ambofaciens with against bacteria and Toxoplasma gondii activities, and also has antiparasitic effect. Spiramycin is composed of a 16-member lactone ring, on which three sugars (mycaminose, forosamine, and mycarose) are attached[1][2].

• HY-Y0055

  Phenothiazine	Inhibitor	99.90%
  Phenothiazine is an antibiotic which has insecticidal, fungicidal, antibacterial and anthelmintic activities. Phenothiazine also can be used for the research of neurological diseases[1][2].

• HY-N0740

  Jatrorrhizine chloride	Inhibitor
  Jatrorrhizine chloride is an alkaloid isolated from?Coptis chinensis with neuroprotective, antimicrobial, antiplasmodial and antioxidant activities[1]. Jatrorrhizine chloride is a potent and orally active inhibitor of?AChE?(IC50=872 nM) over >115-fold selectivity for BuChE[2]. Jatrorrhizine chloride reduces uptake of serotonin (5-HT) and norepinephrine (NE) via inhibition of uptake-2 transporters[3].

• HY-W012531

  2-Hydroxycinnamic acid	Inhibitor
  2-Hydroxycinnamic acid is a phenolic acid with antimicrobial and antioxidant properties. 2-Hydroxycinnamic acid has antimicrobial activity against Staphylococcus aureus and is not susceptible to drug resistance. 2-Hydroxycinnamic acid shows inhibitory effects on infection of HIV/SARS-CoV S pseudovirus with an IC50 of 0.3 mM. In addition, 2-Hydroxycinnamic acid has neuroprotective and antitumor activity[1][2][3][4].

• HY-W247616

  (4-Aminobenzyl)phosphonic acid	Inhibitor
  (4-Aminobenzyl)phosphonic acid is a bioactive compound with potential anticancer and antibacterial activities. (4-Aminobenzyl)phosphonic acid is widely used in compound synthesis to develop new inhibition methods. Through its unique structure, (4-Aminobenzyl)phosphonic acid can effectively interact with biological targets.

• HY-N7432

  DIMBOA	Inhibitor
  DIMBOA, an antibiotic, has antibacterial properties and inhibits bacteria such as Staphylococcus aureus and the mycotoxin-producing fungus Fusarium graminearum (which causes scab). DIMBOA exhibits strong free radical scavenging activity and weak iron(III) ion reducing activity, and has antioxidant activity. DIMBOA inhibits the biosynthesis and accumulation of toxic trichothecenes by affecting the expression of Tri6 and Tri5. DIMBOA reduces plant susceptibility to scab. DIMBOA also exhibits cytotoxicity to plant cells, causing plasmolysis, cell collapse, and cell rupture[1][2][3][4][5].

• HY-147819

  DNA Gyrase-IN-3	Inhibitor
  DNA Gyrase-IN-3 (Compound 28) is a bacterial DNA gyrase B inhibitor with IC50s of 5.41-15.64 µM for E. coli DNA gyrase. Anti-tubercular and antibacterial activity[1].

• HY-B0220H

  Erythromycin hydrochloride	Inhibitor
  Erythromycin hydrochloride is a protein synthesis inhibitor with activity against the growth of both Gram-negative and Gram-positive bacteria. Erythromycin hydrochloride is commonly used in biomedicine to inhibit diseases caused by bacterial infections. Erythromycin hydrochloride is also involved in the inhibition of mammalian mRNA splicing. The application range of erythromycin hydrochloride includes respiratory tract infections, skin infections, and other infections caused by sensitive bacteria[1].

• HY-123325

  Kapurimycin A1	Inhibitor
  Kapurimycin A1 is an anbitiotic that can be isolated from Streptomyces. Kapurimycin A1 has a significant inhibitory effect on Gram-positive bacteria, exhibits cytotoxicity to cultured mammalian cells, and shows strong antitumor activity against the mouse leukemia P388 cell line[1].

• HY-149271

  Anti-MRSA agent 7	Inhibitor
  Anti-MRSA agent 7 (Compound 12) is a potent antibacterial agent. Anti-MRSA agent 7 inhibits S. aureus DNA gyrase, E. coli DNA gyrase, S. aureus topo IV and E. coli topo IV with IC50s of 0.185, 0.365, 0.341 and 0.059 μM, respectively[1].

• HY-N6725S

  Sterigmatocystine-13C18	Inhibitor
  Sterigmatocystine-13C18 is 13C labeled 2,6-Dimethoxyphenol (HY-W003972). 2,6-Dimethoxyphenol is a phenolic compound that is extensively used for the measurement of laccase activity[1].

• HY-W013780S

  Fmoc-Pro-OH-1-13C	Inhibitor
  Fmoc-Pro-OH-1-13C is a 13C-labeled Sulfabenzamide. Sulfabenzamide (N-Sulfanilylbenzamide) is an antimicrobial agent and usually consumed in combination with Sulfathiazole and Sulfacetamide. Sulfabenzamide is effective against Gram-positive and negative ba

• HY-163454

  NorA-IN-2	Inhibitor
  NorA-IN-2 (compound DZ-3) is a potent NorA inhibitor. NorA-IN-2 shows NorA efflux pump inhibitors (EPI) activity[1].

• HY-123022

  Tomopenem	Inhibitor
  Tomopenem (CS-023; RO4908463; R-115685) is a longer-half-life parenteral carbapenem. Tomopenem shows broad activity against 63 reference species. The activity of tomopenem against 293 clinical isolates is potent (MIC90, 0.06 to 4 μg/mL). Antianaerobic activity[1].

• HY-151936

  LmNADK1-IN-1	Inhibitor
  LmNADK1-IN-1 (compound MC1) is an inhibitor of nicotinamide adenine dinucleotide kinases (NADK1) from L. monocytogenes with a Ki value of 54 nM. LmNADK1-IN-1 can be used for the research of bacterial infection[1]. LmNADK1-IN-1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-N8206

  Chrysophanol tetraglucoside	Inhibitor
  Chrysophanol tetraglucoside possesses anti-hypolipidemic and antibacterial activities[1][2].

• HY-127160R

  Benzoxonium (chloride) (Standard)	Inhibitor
  Benzoxonium (chloride) (Standard) is the analytical standard of Benzoxonium (chloride). This product is intended for research and analytical applications. Benzoxonium chloride is an anti-leishmanial agent. Benzoxonium chloride inhibits bacteria, certain protozoa, yeasts and non-spore forming organisms[1].

• HY-N0683R

  α-Vitamin E (Standard)	Inhibitor
  α-Vitamin E (Standard) is the analytical standard of α-Vitamin E. This product is intended for research and analytical applications. α-Vitamin E ((+)-α-Tocopherol), a naturally occurring vitamin E form, is a potent antioxidant[1][2].

• HY-168853

  Antibacterial agent 261	Inhibitor
  Antibacterial agent 261 (compound 43) is a potent inhibitor of peptidomimetic peptide deformylase (PDF), with IC50 of 2.5 and 10.6 nM for S. aureus and E. coli, respectively[1].

• HY-14865S

  Omadacycline-d9		99.21%
  Omadacycline-d9 (PTK 0796-d9; Amadacycline-d9) is the deuterium labeled Omadacycline (HY-14865) that can be used as the internal standard for the analysis of Omadacycline[1].

• HY-111154

  BPH-608	Inhibitor
  BPH-608 is a bacterial undecenyl diphosphate synthase (UPPS) inhibitor (IC50=590 nM) with antibacterial activity[1].

• HY-17395B

  Terbinafine lactate	Inhibitor
  Terbinafine lactate (TDT 067 lactate) is an orally active and potent antifungal agent. Terbinafine lactate is a potent non-competitive inhibitor of squalene epoxidase from Candida, with a Ki of 30 nM. Terbinafine lactate also shows antibacterial activity against certain Gram-positive and Gram-negative bacteria[1][2][3]. Terbinafine (lactate) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-B0519BR

  Tylosin (phosphate) (Standard)	Inhibitor
  Tylosin (phosphate) (Standard) is the analytical standard of Tylosin (phosphate). This product is intended for research and analytical applications. Tylosin phosphate is a macrolide antibiotic found naturally as a fermentation product of Streptomyces fradiae. Tylosin tartrate exerts potent antimicrobial activity against Gram-positive bacteria. Tylosin phosphate is widely used as a feed additive for promoting animal growth. Tylosin phosphate is used for veterinary purposes against bacterial dysentery and respiratory diseases in poultry, pigs and cattle[1][2][3].

• HY-151514

  Antituberculosis agent-5	Inhibitor	99.76%
  Antituberculosis agent-5 (compound 52) is a nitrofuranylamide derivative, inhibits M. tuberculosis UDP-Gal mutase. Antituberculosis agent-5 inhibits Glf activity with an IC50 value of 99 μM/mL and resists tuberculosis (TB) with a MIC value of 1.6 μg/mL[1].

• HY-N14665

  Atrovenetin	Inhibitor
  Atrovenetin is an antibiotic found in Penicillium species. Atrovenetin has inhibitory activity against Bacillus subtilis and Staphylococcus aureus. Atrovenetin is also a potent antioxidant.

• HY-W686760A

  Bromamphenicol	Inhibitor
  Bromamphenicol (Compound Ib) is a derivative of chloramphenicol (HY-B0239), and exhibits antibacterial activity. Bromamphenicol binds to S50 ribosomal subunit, interfers with the activity of peptidyl transferase, and exhibits inhibitory activity against protein synthesis[1].

• HY-P10907

  Zaloganan	Inhibitor
  Zaloganan exhibits board-spectrum antibacterial activity through disruption of bacterial membranes[1].

• HY-B0455AR

  Lomefloxacin (Standard)	Inhibitor
  Lomefloxacin (Standard) is the analytical standard of Lomefloxacin. This product is intended for research and analytical applications. Lomefloxacin (SC47111A) is a broad-spectrum quinolone antibiotic, with antimicrobial activity. Lomefloxacin is used for the research of respiratory tract infections, genitourinary infections, gastrointestinal infections, ENT infections, etc.[1].

• HY-P10158

  PMAP-36	Inhibitor
  PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance[1].

• HY-B0322R

  Sulfamethoxazole (Standard)	Inhibitor
  Sulfamethoxazole (Standard) is the analytical standard of Sulfamethoxazole. This product is intended for research and analytical applications. Sulfamethoxazole (Ro 4-2130) is a sulfonamide bacteriostatic antibiotic, used for bacterial infections. Sulfonamides is a competitive antagonists of para-aminobenzoic acid (PABA)[1].

• HY-14137

  Rimonabant Hydrochloride	Inhibitor	99.79%
  Rimonabant Hydrochloride (SR 141716A Hydrochloride) is a highly potent and selective central cannabinoid receptor (CB1) antagonist with an Ki of 1.8 nM. Rimonabant Hydrochloride (SR 141716A Hydrochloride) also inhibits Mycobacterial membrane protein Large 3 (MMPL3).

• HY-40156A

  Mycobacterium Tuberculosis-IN-5	Inhibitor
  Mycobacterium Tuberculosis-IN-5 (Compound 11) is the HCl salt form of 5-Fluoroindole (HY-40156). Mycobacterium Tuberculosis-IN-5 is an antibacterial agent, that inhibits Mycobacterium tuberculosis with a MIC of 29.1 μM. Mycobacterium Tuberculosis-IN-5 exhibits metabolic stability in rat liver microsomes. Mycobacterium Tuberculosis-IN-5 exhibits anti-tuberculosis efficacy in mice[1].

• HY-125524

  Antibacterial agent 199	Inhibitor
  Antibacterial agent 199 (Compound 2) is an activator for caseinolytic protease (ClpP) with a Kd of 0.7 μM. Antibacterial agent 199 exhibits antibacterial efficacy against Gram-positive strains Staphylococcus aureus, Streptococcus pneumoniae and Gram-negative strain Neisseria meningitidis, with MICs of 16, 0.5 and 0.5 μg/mL, respectively[1].

• HY-W412175

  Coproporphyrin III dihydrochloride		99.57%
  Coproporphyrin III dihydrochloride is a bioactive molecule excreted by nostril- and skin-associated Propionibacterium species that induces aggregation of Staphylococcus aureus (conditions: during early stationary phase growth, low pH: 4-6). Coproporphyrin III dihydrochloride also induces plasma-independent biofilm formation on abiotic surfaces by Staphylococcus aureus. Coproporphyrin III dihydrochloride may be an important mediator of S. aureus accumulation and/or biofilm formation in the nostrils or other sites where Propionibacterium and S. aureus inhabit[1].

• HY-129751

  Nitrovin hydrochloride	Inhibitor
  Nitrovin hydrochloride is an antibacterial growth promoter. Nitrovin hydrochloride induces ROS-mediated non-apoptotic and apoptotic-like cell death by targeting TrxR1. Nitrovin hydrochloride has anticancer activity, with IC50 values of 1.31-6.60 μM for tumor and normal cells[1].

• HY-14768R

  Favipiravir (Standard)
  Favipiravir (Standard) is the analytical standard of Favipiravir. This product is intended for research and analytical applications. Favipiravir (T-705) is a potent viral RNA polymerase inhibitor, it is phosphoribosylated by cellular enzymes to its active form, Favipiravir-ribofuranosyl-5′-triphosphate (RTP). Favipiravir-RTP inhibits the influenza viral RNA-dependent RNA polymerase (RdRP) activity with an IC50 of 341 nM.

• HY-107784R

  Ectoine (Standard)
  Ectoine (Standard) is the analytical standard of Ectoine. This product is intended for research and analytical applications. Ectoine is a natural cell protectant, an amino acid derivate produced by bacteria living under extremely harsh environmental conditions. Ectoine serves as an osmoregulatory compatible solute, increasing the hydration of the skin surface and stabilizing lipid layers, which is useful in skincare. Ectoine demonstrates a good safety profile for the treatment of allergic rhinitis[1][2].

• HY-B1828

  Spectinomycin	Inhibitor
  Spectinomycin is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin is also a noncompetitive inhibitor of td intron RNA[1][2][3][4][5].

• HY-161258

  Antibacterial agent 181	Inhibitor
  Antibacterial agent 181 (Compound 3f) is a potent ciprofloxacin cationic antibacterial agent with low cytotoxicity. The MIC values of Antibacterial agent 181 against Staphylococcus aureus and Escherichia coli are both 2 μg/mL[1].

• HY-123515

  Clorobiocin	Inhibitor
  Clorobiocin is a MlaC protein inhibitor that could bind to the MlaC protein. Clorobiocin has antibacterial effects[1].

• HY-N14187

  Aspergillic acid	Inhibitor
  Aspergillic acid is an antibiotic found in Aspergillus flavus. Aspergillic acid has a broad spectrum of antibacterial activity[1].

• HY-105967A

  Dicresulene diammonium	Inhibitor	99.48%
  Dicresulene diammonium is an impurity of Policresulen, an organic acid with hemostatic, antimicrobial and antiviral activities[1][2].

• HY-N8489

  1-Methoxyphaseollidin	Inhibitor	99.11%
  1-Methoxyphaseollidin, a flavonoid compound, is a lysoPAF acetyltransferase inhibitor, with an IC50 of 48 μM. 1-Methoxyphaseollidin exhibits anti-H.pylori activity against the CLAR and AMOX-resistant strain as well as four CLAR (AMOX)-sensitive strains[1][2][3].

• HY-B0510C

  Trimethoprim lactate	Inhibitor	99.97%
  Trimethoprim lactate is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim lactate is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim lactate has the potential for the research of urinary tract infections, Shigellosis and Pneumocystis pneumonia. Trimethoprim lactate can inhibit infection of Influenza A virus in chick embryo when combinated with zinc[1][2][3][4].

• HY-122975

  Metronidazole Benzoate	Inhibitor	99.92%
  Metronidazole Benzoate, derives from a metronidazole and a benzoic acid, has a role as an antibacterial, antimicrobial, antiparasitic, and antitrichomonal agent[1].

• HY-19640

  AG-85
  AG-85 is a major secretion protein of Mycobacterium tuberculosis, and can be identified in ancient bone[1].

• HY-P4855

  CRAMP (mouse)		98.33%
  CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections[1].

• HY-P1607

  Nisin
  Nisin is a bacteriocin produced by a group of Gram-positive bacteria that belongs to Lactococcus and Streptococcus species. Nisin has antibacterial and anti-inflammatory activity[1][2][3].

• HY-B0925R

  Oxacillin (sodium salt) (Standard)	Inhibitor
  Oxacillin (sodium salt) (Standard) is the analytical standard of Oxacillin (sodium salt). This product is intended for research and analytical applications. Oxacillin sodium salt is an orally active synthetic penicillin with good bactericidal activity against staphylococci and other gram-positive pathogens[1].

• HY-N0113

  Hordenine	Inhibitor	99.88%
  Hordenine, an alkaloid found in plants, inhibits melanogenesis by suppression of cyclic adenosine monophosphate (cAMP) production[1].

• HY-B0322A

  Sulfamethoxazole sodium	Inhibitor	99.79%
  Sulfamethoxazole sodium (Ro 4-2130 sodium) is a sulfonamide bacteriostatic antibiotic[1]. Sulfamethoxazole sodium is used to treat various urinary tract pathogens and in combination with Trimethoprim is considered the gold standard in the treatment of urinary tract infections (UTIs)[2].

• HY-W026644

  Acridine-9-carboxaldehyde
  Acridine-9-carboxaldehyde (Acridine-9-carbaldehyde) is a bioactive compound with potential antibacterial and antitumor activities. Acridine-9-carboxaldehyde is widely used as a building block in compound development to synthesize various bioactive derivatives. Acridine-9-carboxaldehyde exhibits significant cytotoxicity against certain cancer cells, making it an important candidate in cancer inhibition research.

• HY-139754

  Antibacterial agent 37	Inhibitor
  Antibacterial agent 37 is an antibacterial agent extracted from patent WO2015063714A1, compound B. Antibacterial agent 37 can be used for the research of bacterial infections[1].

• HY-15781A

  (R)-Morinidazole	Inhibitor
  (R)-Morinidazole is an orally active and 5-nitroimidazole antimicrobial agent that undergoes extensive metabolism in humans via N+-glucuronidation and sulfation. (R)-Morinidazole can be used for bacterial infections research including appendicitis and pelvic inflammatory disease (PID) caused by anaerobic bacteria[1].

• HY-P2324A

  Gramicidin A TFA	Inhibitor
  Gramicidin A (TFA) is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Gramicidin A (TFA) is a highly hydrophobic channel-forming ionophore that forms channels in model membranes that are permeable to monovalent cations. Gramicidin A (TFA) induces degradation of hypoxia inducible factor 1 α (HIF-1α)[1][2].

• HY-119630R

  Propineb (Standard)	Inhibitor
  Propineb (Standard) is the analytical standard of Propineb. This product is intended for research and analytical applications. Propineb (Zinc propylenebis) is a compound widely used in fruit and vegetables cultures, due to its large spectrum of activity against fungal plant diseases[1].

• HY-B1173

  (+)-Camphor	Inhibitor
  (+)-Camphor is a food additive used medicinally as a preservative.

• HY-N3342

  Macrocarpal E	Inhibitor
  Macrocarpal E is a potent antibacterial agent. Macrocarpal E is a phloroglucinol dialdehyde diterpene derivatives that can be found in the leaves of Eucalyptus macrocarpa[1].

• HY-B1691

  Methenamine hippurate	Inhibitor	99.55%
  Methenamine hippurate (Hexamine hippurate) is an orally active urinary antiseptic agent with a wide antibacterial spectrum. Methenamine hippurate is effective against most common urinary tract pathogens[1][2].

• HY-A0162

  Quinupristin	Inhibitor	98.05%
  Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits[1] [2].

• HY-136638

  ML328	Inhibitor	98.59%
  ML328 is a selective inhibitor of bacterial AddAB and RecBCD helicase-nucleases with IC50 values of 26 and 5.1 μM, respectively. ML328 is a gyrase inhibitor. ML328 strongly inhibits the growth of E. coli in the presence of phage. ML328 can be used for the research of bacterial infection[1][2].

• HY-123598

  Corynecin III	Inhibitor
  Corynecin III is a Chloramphenicol (HY-B0239)-like antibiotic, which is found in Corynebacterium. Corynecin III inhibits the growth of Gram-positive and Gram-negative bacteria with MIC values of 2.6-83 μg/mL[1].

• HY-W008226R

  Phloracetophenone (Standard)	Inhibitor
  Oxprenolol (hydrochloride) (Standard) is the analytical standard of Oxprenolol (hydrochloride). This product is intended for research and analytical applications. Oxprenolol hydrochloride (Ba 39089) is an orally bioavailable β-adrenergic receptor (β-AR) antagonist with a Ki of 7.10 nM in a radioligand binding assay using rat heart muscle[1].

• HY-P10306

  Cys-LL37	Inhibitor
  Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials[1].

• HY-109587A

  BM635 hydrochloride	Inhibitor
  BM635 hydrochloride is a MmpL3 inhibitor with outstanding anti-mycobacterial activity. BM635 hydrochloride has an MIC50 of 0.08 μM against M.tuberculosis H37Rv. BM635 hydrochloride doubles the in vivo exposure with respect to the free base BM635[1].

• HY-N10087

  Angustifoline	Inhibitor
  Angustifoline, an alkaloid, can be isolated from Lupinus angustifolius L. alkaloid extract. Angustifoline exhibits antimicrobial activity. Angustifoline could have bacteriostatic effects against S. aureus, B. subtilis, E. coli, P. aeruginosa and B. thuringiensis[1].

• HY-121096

  Funalenone	Inhibitor
  Funalenone (BMS-304245) is a MraY + MurG inhibitor with an IC50 of 25.5 μM in a MraY + MurG membrane plate assay. Funalenone inhibits Staphylococcus aureus (A15090) with an MIC of 64 μg/mL. Funalenone also inhibits MMP-1 with an IC50 of 170 μM[1][2].

• HY-N6908

  Continentalic acid	Inhibitor	98.89%
  Continentalic acid from Aralia continentalis has minimum inhibitory concentrations (MICs) of approximately 8-16 µg/mL against S. aureus, including the Methicillin (HY-121544) susceptible Staphylococcus aureus (MSSA) and Methicillin-resistant Staphylococcus aureus (MRSA) standard strains[1].

• HY-163104

  Antibacterial agent 169	Inhibitor
  Antibacterial agent 169 (Compound 28) is a pyrrolamide-type GyrB/ParE inhibitor with antibacterial activity. Antibacterial agent 169 has an inhibitory effect on Gyrase and Topo IV of Staphylococcus aureus, with IC50 values of 49 nmol/L and 1.513 μmol/L respectively[1].

• HY-145286

  IMPDH2-IN-2		99.73%
  IMPDH2-IN-2 is a potent inhibitor of inosine 5’-monophosphate dehydrogenase (IMPDH) with a Ki,app value of 14 μM, respectively. IMPDH2-IN-2 displays moderate antibacterial activity (MIC = 6.3 and 11 μM in minimal GAST/Fe and rich 7H9/ADC/Tween media, respectively). IMPDH2-IN-2 is a potential anti-tuberculosis agent[1].

• HY-P5617

  Cathepsin G(1-5)	Inhibitor
  Cathepsin G(1-5) is an antimicrobial peptide that can be found in the clostripain-digested cathepsin G mixture[1].

• HY-P2047

  Lavendomycin	Inhibitor
  Lavendomycin is a peptide antibiotic from Streptomyces. Lavendomycin inhibits Gram-positive bacteria[1].

• HY-143326

  Antibacterial agent 83	Inhibitor
  Antibacterial agent 83 (compound 17h) displays potent antibacterial activity against various vancomycin-resistant Enterococcus faecalis (VRE) and methicillin-resistant Staphylococcus aureus (MRSA). Antibacterial agent 83 can significantly reduce the biofilm formation of MRSA and exhibited promising selectivity. Antibacterial agent 83 is metabolically stable in human liver microsomes[1].

• HY-151458

  VEGFR-2/DHFR-IN-1	Inhibitor
  VEGFR-2/DHFR-IN-1 (compound 8b) is an inhibitor of VEGFR-2 and DHFR with IC50s of 0.384 and 7.881 μM, respectively. VEGFR-2/DHFR-IN-1 shows good antibacterial activities against Escherichia coli, Streptococcus faecalis, Salmonella enterica, MSSA and MRSA with MIC values of 16, 16, 16, 8, and 16 μg/mL, respectively. VEGFR-2/DHFR-IN-1 exhibits good cytotoxic activities against C26, HepG2, and MCF7 cancer cell lines with IC50 values of 2.97-7.12 μM. VEGFR-2/DHFR-IN-1 can be used for the research of cancer[1].

• HY-N2567

  (±)-Decursinol	Inhibitor	98.58%
  (±)-Decursinol is a potent FtsZ inhibitor. (±)-Decursinol inhibits B. anthracis FtsZ polymerization with an IC50 of 102 μM[1].

• HY-B0220R

  Erythromycin (Standard)	Inhibitor
  Erythromycin (Standard) is the analytical standard of Erythromycin. This product is intended for research and analytical applications. Erythromycin is a macrolide antibiotic produced by actinomycete?Streptomyces erythreus?with a broad spectrum of antimicrobial activity. Erythromycin binds to bacterial 50S ribosomal subunits and inhibits?RNA-dependent protein synthesis?by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid[1][2]. Erythromycin also exhibits antitumor and neuroprotective effect in different fields of research[3][4].

• HY-13678S

  Meropenem-d6	Inhibitor
  Meropenem-d6 is the deuterium labeled Meropenem. Meropenem (SM 7338) is a carbapenem antibiotic with broad-spectrum antibacterial activity. Meropenem has activity against susceptible and resistant N. gonorrhoeae (MIC value of 0.02-0.06 mg/mL), H. influenzae (MIC value of 0.03-0.12 mg/mL), and H. ducreyi (MIC value of 0.015-0.12 mg/mL)[1][2].

• HY-125496

  A201A	Inhibitor
  A201A is a aminoacylnucleoside antibiotic with antibacterial activities. A201A is highly effective against Gram-positive and most Gram-negative anaerobic bacteria. A201A inhibits tRNA accommodation during translation[1][2].

• HY-B0698A

  Ceftibuten dihydrate	Inhibitor
  Ceftibuten (Sch-39720) dihydrate, an antibiotic, is an orally active cephalosporin, possesses potent activity in vitro against a wide range of gram-negative and certain gram-positive pathogens[1][2].

• HY-161124

  Antibacterial agent 175	Inhibitor
  Antibacterial agent 175 (compound Y40), a ML346 (HY-18669) analog, is a Sortase A (SrtA) inhibitor. Antibacterial agent 175 shows inhibitory activity on Staphylococcus aureus SrtA and shows inhibitory effects on biofilm formation. Antibacterial agent 175 is an antivirulence agent against S. aureus infections[1].

• HY-144701R

  SABA1 (Standard)	Inhibitor
  Fluopicolide (Standard) is the analytical standard of Fluopicolide. This product is intended for research and analytical applications. Fluopicolide is the active compound.

• HY-N10155A

  BE-18591	Inhibitor
  BE-18591 shows antimicrobial activity against gram-positive and some gram-negative bacteria. BE-18591 inhibited the growth of the MKN-45 cell line (IC50= 0.285 μg/mL) and the P388 cell line (IC50= 0.52 μg/mL)[1].

• HY-151280

  Antifungal agent 37	Inhibitor
  Antifungal agent 37 is a geterocyclic disulfide, with antifungal activity[1].

• HY-14648S5

  Dexamethasone-d3-1	Inhibitor	98.02%
  Dexamethasone-d3-1 (Hexadecadrol-d3-1; Prednisolone F-d3-1) is a deuterium labeled Dexamethasone (HY-14648). Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

• HY-124814

  C215		99.63%
  C215 is a potent inhibitor of MmpL3. C215 is identified in HTS with glycerol independent activity against M. tuberculosis, limited non-specific toxicity against mammalian cells, an IC90 of 16 μM against M. tuberculosis, and efficacy against M. tuberculosis growing in macrophages[1].

• HY-W011117R

  Danofloxacin (Standard)	Inhibitor
  Danofloxacin (Standard) is the analytical standard of Danofloxacin. This product is intended for research and analytical applications. Danofloxacin is a third generation fluoroquinolone and orally active antimicrobial agent. Danofloxacin shows a broad spectrum of activity against most Gram-negative and Gram-positive bacteria, mycoplasma and chlamydia species, and plays an antimicrobial role by inhibition of bacterial DNA-gyrase. Danofloxacinh has the potential for respiratory diseases in cattle, swine, and chickens treatment[1][2].

• HY-124469

  UM-C162	Inhibitor
  UM-C162, a benzimidazole derivative, can rescue nematodes from a S. aureus infection. UM-C162 prevents the formation of biofilm without interfering with bacterial viability. UM-C162 mediates the disruption of S. aureus hemolysins, proteases and clumping factors production. UM-C162 has the potential to be used as an anti-virulence agent to control S. aureus infections[1].

• HY-162672

  Antibacterial agent 231	Inhibitor
  Antibacterial agent 231 (derivative 8) is an antimicrobial agent against multidrug-resistant Helicobacter pylori (H. pylori) with a minimum inhibitory concentration of 0.25–0.5 μg/mL. Antibacterial agent 231 directly targets the protein transposase subunit SecA and the outer membrane protein assembly factor BamD to inhibit the trafficking and assembly of bacterial outer membrane proteins (OMPs). Antibacterial agent 231 can be used to study the effects of antibiotic treatment on intestinal microbial balance[1].

• HY-B1794A

  Thiethylperazine dimaleate	Inhibitor	99.99%
  Thiethylperazine dimaleate, a phenothiazine derivate, is an orally active and potent dopamine D2-receptor and histamine H1-receptor antagonist. Thiethylperazine dimaleate is also a selective ABCC1activator that reduces amyloid-β (Aβ) load in mice. Thiethylperazine dimaleate has anti-emetic, antipsychotic and antimicrobial effects[1][2][3].

• HY-N1428S1

  Citric acid-13C6	Inhibitor
  Citric acid-13C6 is the 13C-labeled Citric acid. Citric acid is a weak organic tricarboxylic acid found in citrus fruits. Citric acid is a natural preservative and food tartness enhancer.

• HY-170519

  K13787	Inhibitor
  K13787 is an acetohydroxyacid synthase (AHAS) inhibitor with antibacterial activity. K13787 has antibacterial activity against a variety of nontuberculous mycobacteria (NTM) and clarithromycin (CLR) resistant strains[1].

• HY-113795

  Aldgamycin E	Inhibitor
  Aldgamycin E is a neutral macrolide antibiotic that can be derived from culture filtrates of Streptomyces lavendulae. Aldgamycin E has antibacterial activity[1].

• HY-P10814

  MciZ (B. subtilis)	Inhibitor
  MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation[1].

• HY-158320

  T3SS-IN-5
  T3SS-IN-5 (Compound F9) is a specific inhibitor of the type III secretion system (T3SS). T3SS-IN-5 reduces bacterial pathogenicity without affecting bacterial viability by inhibiting the expression of genes associated with T3SS[1].

• HY-U00087

  Tosylchloramide sodium trihydrate	Inhibitor
  Tosylchloramide sodium trihydrate (Chloramine T sodium trihydrate) is a disinfectant agent widely used in laboratories, kitchens and hospitals. It is also used as a biocide in air fresheners and deodorants.

• HY-117990

  GSK572A	Inhibitor
  GSK572A is a potent EchA6 inhibitor with an Kd value of 1.9 µM. GSK572A shows anti-tubercular activity[1].

• HY-118099

  Florfenicol amine hydrochloride	Inhibitor	99.45%
  Florfenicol amine hydrochloride is a metabolite of Florfenicol (HY-B1374). Florfenicol inhibits bacterial protein synthesis by binding to 50S and 70S subunits in the ribosome to abolish the activity of peptidyltransferase. Florfenicol, is a veterinary antibiotic, can be used in aquaculture to control susceptible bacterial diseases[1][2].

• HY-B1464

  Cetylpyridinium chloride	Inhibitor
  Cetylpyridinium chloride, a cationic quaternary ammonium compound, is an anti-bacterial agent with broad-spectrum activity. Cetylpyridinium chloride is an effective anti-HBV capsid assembly inhibitor with an IC50 of 2.5 μM. Cetylpyridinium chloride is used in pesticides and various types of mouthwashes, and other personal care products[1][2].

• HY-E70250

  Neocryptolepine	Inhibitor
  Neocryptolepine (Cryptotackieine) has antiplasmodial activity. Neocryptolepine also shows antibacterial activity against Gram-positive bacteria (MIC < 100 μg/mL), and antifungal activity[1][2].

• HY-18716

  Dextrorotation nimorazole phosphate ester	Inhibitor
  Dextrorotation nimorazole phosphate ester is an anti-anaerobic and anti-parasitic agent.

• HY-13662C

  (S)-Lansoprazole	Inhibitor	99.17%
  (S)-Lansoprazole (Levolansoprazole) is an isoform of Lansoprazole (HY-13662), which is an orally active proton pump inhibitor which prevents the stomach from producing acid. Lansoprazole (AG 1749) is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor)[1][2].

• HY-10586

  5-Azacytidine	Inhibitor
  5-Azacytidine (Azacitidine; 5-AzaC; Ladakamycin) is a nucleoside analogue of cytidine that specifically inhibits DNA methylation. 5-Azacytidine is incorporated into DNA to covalently trap DNA methyltransferases and contributes to reverse epigenetic changes[1][2]. 5-Azacytidine induces cell autophagy[4].

• HY-66011AR

  Moxifloxacin (Standard)	Inhibitor
  Moxifloxacin (Standard) is the analytical standard of Moxifloxacin. This product is intended for research and analytical applications. Moxifloxacin is an orally active 8-methoxyquinolone antimicrobial for use in the treatment of acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1][2].

• HY-146165

  Metallo-β-lactamase-IN-8	Inhibitor
  Metallo-β-lactamase-IN-8 (compound 17) is a potent, reversible and competitive broad-spectrum inhibitor of metallo-β-lactamases (MβLs), with IC50s of 1.3 μM, 5.7 μM, 9.8 μM, and 9.9 μM for L1, ImiS, IMP-1 and VIM-2, respectively. Metallo-β-lactamase-IN-8 exhibits antibacterial activity[1].

• HY-151960

  Antitubercular agent-36	Inhibitor
  Antitubercular agent-36 (compound 53) is an antitubercular agent. Antitubercular agent-36 inhibits the growth of MtbH37Rv with a MIC90 value of 1.25 μg/mL. Antitubercular agent-36 can be used for the research of tuberculosis[1].

• HY-16566A

  Kanamycin sulfate	Inhibitor
  Kanamycin (Kanamycin A) sulfate is an orally active antibacterial (gram-negative/positive bacteria) agent, inhibits translocation and causes misencoding by binding to the 70 S ribosomal subunit. Kanamycin sulfate shows good inhibitory activity to both M. tuberculosis (sensitive and drug-resistant ) and K. pneumonia, which can be used in studies of tuberculosis and pneumonia[1][2][3][4].

• HY-157130

  T3SS-IN-3	Inhibitor
  T3SS-IN-3 (compound F-24) is an inhibitor of type III secretion system (T3SS). T3SS-IN-3 inhibits the transcription of hrpY gene significantly without inhibiting bacterial growth[1].

• HY-144721

  Antitubercular agent-11
  Antitubercular agent-11 (Compound 1e) is an antitubercular agent. Antitubercular agent-11 with a bulkier electron-donating group (Bu-t) demonstrated the best MIC value of 0.060 μg/mL[1].

• HY-112565

  MBX-4132	Inhibitor	99.22%
  MBX-4132, a member of a chemical class called oxadiazoles that inhibit trans translation by binding to the bacterial ribosome.

• HY-NP023

  Lactoferrin (human)	Inhibitor
  Lactoferrin (human) is an iron-binding protein. Lactoferrin (human) has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin (human) can be used to culture mutans Streptococcus in iron-restricted medium[1].

• HY-17358S1

  Loteprednol Etabonate-d3	Inhibitor
  Loteprednol Etabonate-d3 is the deuterium labeled Loteprednol Etabonate. Loteprednol etabonate (LE) is an orally active "soft" steroid belonging to a unique class of glucocorticoids. Loteprednol etabonate (LE) exhibits anti-inflammatory activity and has been used in optometry and ophthalmology[1][2][3].

• HY-13579R

  BTZ043 (Standard)	Inhibitor

• HY-116933

  Murrayanol	Inhibitor
  Murrayanol is a natural carbazole alkaloid with a variety of biological activities. Murrayanol shows anti-inflammatory, topoisomerase I and topoisomerase II (Topoisomerase) inhibition activities. Murrayanol also as a mosquitocidal and antimicrobial[1].

• HY-B2227C

  Lactate potassium	Inhibitor
  Lactate (Lactic acid) potassium is used as a sodium chloride substitute in the elaboration of dry meat products. Lactate potassium (56%) and sodium diacetate (4%) mixture inhibit the development of L. sake and L. monocytogenes bacteria at 4℃ to extend the shelf life of food[1][2].

• HY-142075

  Antibacterial agent 134	Inhibitor
  Antibacterial agent 134 (compound 1) is an diketopiperazine alkaloid with antimicrobial activity. Antibacterial agent 134 is the major metabolite in the culture of Hymeniacidon perleve associated bioactive bacterium Pseudomonas sp. NJ6-3-1[1].

• HY-B0688S1

  Dapsone-d4	Inhibitor
  Dapsone-d4 is the deuterium labeled Dapsone. Dapsone (4,4′-Diaminodiphenyl sulfone) is an orally active and blood-brain penetrant sulfonamide antibiotic with bacteriostatic, antimycobacterial and antiprotozoal activities[1]. Dapsone exerts effective antileprosy activity and inhibits folate synthesis in cell extracts of M. leprae. Dapsone is used for dermatologic disorder research, including leprosy, dermatitis herpetiformis, acne vulgaris et al[2][3].

• HY-127019R

  Nigericin (Standard)	Inhibitor
  Monosulfuron (Standard) is the analytical standard of Monosulfuron. This product is intended for research and analytical applications. Monosulfuron is a potent herbicide agent. Monosulfuron is an acetolactate synthase (ALS) inhibitor with an IC50 of 32 nmol/L against CAU 3138[1].

• HY-N6294

  Monocerin
  Monocerin is an isocoumarin derivative. Monocerin is isolated from Microdochium bolleyi, an endophytic fungus from Fagonia cretica. Monocerin shows good antifungal, antibacterial, and antialgal activities against Microbotryum violaceum, Escherichia coli, Bacillus megaterium, and Chlorella fusca[1].

• HY-N10320

  (-)-(E)-α-Atlantone	Inhibitor
  (-)-(E)-α-Atlantone is a volatile constituent of Artemisia vestita oil[1].

• HY-P4370

  Hepcidin-20 (human)	Inhibitor
  Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains[1][2][3].

• HY-P1581

  Ceratotoxin A	Inhibitor	99.61%
  Ceratotoxin A, a 29-residue peptide isolated from the accessory gland secretion fluid, with strong anti-bacterial activity.

• HY-P2291

  Beta-defensin 103 isoform X1, pig	Inhibitor
  Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens[1].

• HY-B0318R

  Metronidazole (Standard)	Inhibitor
  Metronidazole (Standard) is the analytical standard of Metronidazole. This product is intended for research and analytical applications. Metronidazole is an orally active nitroimidazole antibiotic. Metronidazole can cross blood brain barrier. Metronidazole can be used for the research of anaerobic infections[1][2][3][4].

• HY-N0322R

  Cholesterol (Standard)		98.23%
  Cholesterol (Standard) is the analytical standard of Cholesterol. This product is intended for research and analytical applications. Cholesterol is the major sterol in mammals. It is making up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins[1][2]. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist[3].

• HY-B0334AR

  Sulbactam (sodium) (Standard)	Inhibitor
  Sulbactam (sodium) (Standard) is the analytical standard of Sulbactam (sodium). This product is intended for research and analytical applications. Sulbactam (CP45899) sodium is a competitive, irreversible beta-lactamase inhibitor. Sulbactam sodium shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus--Acinetobacter baumannii (Acb) complex[1][2].

• HY-B1414R

  Chloroxylenol (Standard)	Inhibitor
  Chloroxylenol (Standard) is the analytical standard of Chloroxylenol. This product is intended for research and analytical applications. Chloroxylenol is a broad-spectrum antibacterial agent that can be used to control bacteria, algae, fungi and viruses[1][2].

• HY-P10345

  OP-145	Inhibitor
  OP-145, an cathelicidin LL-37 derivative, is an antimicrobial peptide, and shows antibacterial activity against several MRSA strains. OP-145 can be used for research of chronic suppurative otitis media[1].

• HY-Y0729

  4-Chlorocinnamic acid	Inhibitor	99.98%
  4-Chlorocinnamic acid has inhibitory effects on tyrosinase. 4-Chlorocinnamic acid has antibacterial activity. 4-Chlorocinnamic acid also inhibits Colletotrichum gloeosporioides growth[1][2][3].

• HY-136559

  6-Azathymine	Inhibitor	99.94%
  6-Azathymine, a 6-nitrogen analog of thymine, is a potent D-3-aminoisobutyrate-pyruvate aminotransferase inhibitor. 6-Azathymine inhibits the biosynthesis of DNA, and has antibacterial and antiviral activities[1][2][3][4].

• HY-B1256S

  Cefuroxime-d3	Inhibitor
  Cefuroxime-d3 is deuterium labeled Cefuroxime (sodium). Cefuroxime sodium is an orally active second-generation cephalosporin antibiotic with increased stability to β-lactamase. Cefuroxime sodium has a broad spectrum activity against Gram-positive and Gram-negative bacteria[1].

• HY-123216

  Cefmatilen	Inhibitor
  Cefmatilen (S-1090) is an orally-active cephalosporin antibiotic that shows high activity against a variety of Gram-positive and Gram-negative bacteria, including Streptococcus pyogenes and Neisseria gonorrhoeae[1].

• HY-B0501S

  Danofloxacin-d3 mesylate	Inhibitor
  Danofloxacin-d3 (mesylate) is the deuterium labeled Danofloxacin mesylate. Danofloxacin mesylate (CP 76136-27) is a fluoroquinolone antibacterial for veterinary use.

• HY-122402

  Umirolimus		99.35%
  Umirolimus, a macrocyclic triene lactone Rapamycin derivative, is powerful immunosuppressant and anti-inflammatory agent. Umirolimus has highly lipophilicity and can be used agent-eluting stent (DES) applications[1].

• HY-P0274A

  PGLa TFA	Inhibitor	99.80%
  PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of antibiotic peptides found in frog skin and its secretions[1].

• HY-15142R

  Doxorubicin (hydrochloride) (Standard)	Inhibitor
  Doxorubicin hydrochloride (Standard) is the analytical standard of Doxorubicin hydrochloride. This product is intended for research and analytical applications. Doxorubicin (Hydroxydaunorubicin) hydrochloride, a cytotoxic anthracycline antibiotic, is an anti-cancer chemotherapy agent. Doxorubicin hydrochloride is a potent human DNA topoisomerase I and topoisomerase II inhibitor with IC50s of 0.8 μM and 2.67 μM, respectively. Doxorubicin hydrochloride reduces basal phosphorylation of AMPK and its downstream target acetyl-CoA carboxylase. Doxorubicin hydrochloride induces apoptosis and autophagy[1][2][3].

• HY-P2120

  Pseudobactin A	Inhibitor
  Pseudobactin A is a non-fluorescent extracellular iron carrier produced by the plant growth-promoting bacterium Pseudomonas B10[1].

• HY-N1673

  2,5-Dihydroxybenzaldehyde	Inhibitor
  2,5-Dihydroxybenzaldehyde (Gentisaldehyde) is a naturally occurring antimicrobial that inhibits the growth of Mycobacterium avium subsp. paratuberculosis. 2,5-Dihydroxybenzaldehyde is active against S. aureus strains with a MIC50 of 500 mg/L[1][2].

• HY-144387

  Antibacterial agent 71	Inhibitor
  ient S. Tm and hyperpermeable Escherichia coli. The potencies against WT strains of E. coli, Acinetobacter baumannii, and Burkholderia cenocepacia are also improved considerably (up to >128-fold) with the outer-membrane permeabi

• HY-B0519AS

  Tylosin-d3	Inhibitor
  Tylosin-d3 is the deuterium labeled Tylosin. Tylosin (Tylosin A) is a macrolide antibiotic found naturally as a fermentation product of Streptomyces fradiae. Tylosin exerts potent antimicrobial activity against Gram-positive bacteria. Tylosin is widely used as a feed additive for promoting animal growth. Tylosin is used for veterinary purposes against bacterial dysentery and respiratory diseases in poultry, pigs and cattle[1][2][3].

• HY-A0294A

  Ertapenem disodium	Inhibitor
  Ertapenem (MK-0826) disodium is a broad spectrum and long acting β-lactam antibiotic. Ertapenem disodium has a broad-spectrum anti-anaerobic activity against a variety of anaerobes with a mode MIC of 0.12 μg/mL. Ertapenem disodium can be used for the research of severe infections caused by bacteria in the skin, lungs, stomach, pelvis, and urinary tract[1][2].

• HY-136954

  LL-BM123γ2	Inhibitor
  LL-BM123γ2 is an antibacterial agent which is active against a variety of microorganisms. LL-BM123γ2 can be used for antibacterial research[1].

• HY-17359S

  Deferasirox-d4	Inhibitor
  Deferasirox-d4 is the deuterium labeled Deferasirox. Deferasirox (ICL 670) is an orally available iron chelator used for the management of transfusional iron overload[1][2][3].

• HY-B0260R

  Methylprednisolone (Standard)		99.67%
  Methylprednisolone (Standard) is the analytical standard of Methylprednisolone. This product is intended for research and analytical applications. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

• HY-P5692

  Maximin 77	Inhibitor
  Maximin 77 is an antimicrobial peptide. Maximin 77 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 77 has hemolytic activities against human red cells[1].

• HY-17035R

  Doramectin (Standard)
  Doramectin (Standard) is the analytical standard of Doramectin. This product is intended for research and analytical applications. Doramectin is a derivative of Ivermectin (HY-15310). Doramectin is a potent antiparasitic antibiotic. Doramectin is an active compound against S.mansoni in an NMRI mouse infection model[1][2][3].

• HY-N7504

  Isopsoralenoside	Inhibitor	99.50%
  Isopsoralenoside is a benzofuran glycoside from Psoralea corylifolia. Isopsoralenoside can be quickly metabolized to Psoralen (HY-N0053) in digestive tract contents. Isopsoralenoside show estrogen-like activity, osteoblastic proliferation accelerating activity, antitumor effects and antibacterial activity[1].

• HY-B0526

  Flumequine	Inhibitor
  Flumequine (R-802) is a quinolone antibiotic, and acts as a topoisomerase II inhibitor, with an IC50 of 15 μM (3.92 μg/mL).

• HY-161988

  Antimicrobial agent-34	Inhibitor
  Antimicrobial agent-34 (compound 4h) is an antibacterial agent (MIC = 1–4 μg/mL), with a clogP value of 9.14. Antimicrobial agent-34 has good plasma stability (HC50 of 131.1 μg/mL) and good membrane selectivity (HC50/MIC is 65.6), with rapid sterilization capability. Antimicrobial agent-34 destroys the integrity of bacterial cell membranes, induces an increase in intracellular reactive oxygen species, and leaks protein and DNA, ultimately leading to bacterial death. Antimicrobial agent-34 demonstrates significant in vivo antibacterial potency in a mouse sepsis model infected with Staphylococcus aureus ATCC43300[1].

• HY-13753

  Streptozotocin	Inhibitor
  Streptozotocin (Streptozocin; STZ) is an antibiotic widely used in experimental animal models of induced diabetes. Streptozotocin enters B cells via the glucose transporter (GLUT2) and causes the alkylation of DNA ( DNA-methylating ). Streptozotocin can induce the apoptosis of β cells[1][2][3].

• HY-N1031

  Vitexolide E	Inhibitor
  Vitexolide E is a diterpenoid compound isolated from the leaves of the Malaysian species Vitex vestita. Vitexolide E shows cytotoxic activities against the HCT-116 cancer cell line and human fetal lung fibroblast MRC5 cell line[1].

• HY-113784

  Thiocarlide
  Thiocarlide is a potent antibacterial agent. Thiocarlide inhibits Mycobacterium tuberculosis H37Rv, Mycobacterium bovisBCG, Mycobacterium avium, and Mycobacterium aurum A+ with MICs of 2.5, 0.5, 2.0 and 2.0 μg/mL, respectively[1].

• HY-163142

  Antibacterial agent 172	Inhibitor
  Antibacterial agent 172 (Compound 6a) is a <,i>Clostridioides difficile (Cd) SpoVD inhibitor (IC50=89 nM) that effectively inhibits sporulation of Clostridioides difficile. Antibacterial agent 172 can be used in the study of bacterial infections[1].

• HY-152096

  (R)-ZG197	Inhibitor
  (R)-ZG197 is a highly selective Staphylococcus aureus Caseinolytic protease P (SaClpP) activator with an EC50 of 1.5 μM. (R)-ZG197 also activates Homo sapiens ClpP (HsClpP) with an EC50 of 31.4 μM[1].

• HY-105717

  Meralein sodium	Inhibitor
  Meralein sodium is an antiseptic agent[1].

• HY-170970

  Mtb-IN-10	Inhibitor
  Mtb-IN-10 (Compound P15) is a Rv1625c/Cya activator that regulates cAMP metabolism to influence the growth of Mycobacterium tuberculosis (Mtb). Mtb-IN-10 exhibits an EC50 of 1.96 µM in an Mtb-infected macrophage model and demonstrates 58.0% oral bioavailability in mice at a 20 mg/kg dose. It may regulate intracellular signaling and disrupt cholesterol metabolism in Mtb, thereby inhibiting bacterial proliferation. Mtb-IN-10 holds potential for tuberculosis (TB) research, particularly for combating multidrug-resistant (MDR-TB) and extensively drug-resistant (XDR-TB) Mtb strains.

• HY-16305S1

  Maribavir-d6 TFA	Inhibitor
  Maribavir-d6 TFA (1263W94-d6 TFA; BW1263W94-d6 TFA; GW257406X-d6 TFA) is a deuterium labeled Maribavir (HY-16305). Maribavir is an orally active antiviral agent for cytomegalovirus (CMV) through inhibition of protein kinase UL97 and the following CMV DNA replication[1].

• HY-B1568AR

  Bromodiphenhydramine (hydrochloride) (Standard)	Inhibitor
  Bromodiphenhydramine (hydrochloride) (Standard) is the analytical standard of Bromodiphenhydramine (hydrochloride). This product is intended for research and analytical applications. Bromodiphenhydramine hydrochloride is a potent antihistamine with antimicrobial property. Bromodiphenhydramine hydrochloride inhibits a large number of Gram negative and Gram positive bacteria. Bromodiphenhydramine hydrochloride can be used for cutaneous allergies research[1][2][3].

• HY-B0992

  Nithiamide	Inhibitor	99.74%
  Nithiamide is a non-5-nitroimidazole drugs, is a antibiotic used in veterinary.

• HY-P5071

  EcAMP3
  EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4[1].

• HY-B0213

  Sulfameter	Inhibitor	99.94%
  Sulfameter (Sulfametoxydiazine; 5-Methoxysulfadiazine) is an effective long-acting sulfonamide antibiotic with antibacterial activities. Sulfameter can be used for the research of urinary tract infections and lepriasis[1].

• HY-B1297R

  Ceforanide (Standard)	Inhibitor
  Ceforanide (Standard) is the analytical standard of Ceforanide. This product is intended for research and analytical applications. Ceforanide is a second generation cephalosporin administered intravenously or intramuscularly. Ceforanide has a spectrum of in vitro antibacterial activity[1].

• HY-W714137

  (6-Isothiocyanatohexyl)(methyl)sulfane
  (6-Isothiocyanatohexyl)(methyl)sulfane (Lesquerellin; 6-Methylthiohexyl isothiocyanate) is an isothiocyanate found in wasabi (W. japonica) and has various biological activities. (6-Isothiocyanatohexyl)(methyl)sulfane is active against the bacterium Bacillus subtilis and the fungus T. mentagrophytes (MIC=25 μg/mL). (6-Isothiocyanatohexyl)(methyl)sulfane also has anthelmintic activity against blue mussel (M. edulis). (6-Isothiocyanatohexyl)(methyl)sulfane has antifouling activity when applied to polyvinyl chloride (PVC) panels at a concentration of 50 μmol/cm2 in a conventional immersion test.

• HY-P5582

  Combi-1	Inhibitor
  Combi-1 is an antimicrobial peptide with broad-spectrum activity against different bacteria and yeast cells[1].

• HY-B0067

  Amrubicin
  Amrubicin (SM-5887) is a DNA topoisomerase II inhibitor, used for the research of cancer.

• HY-B0546AR

  Procaine (hydrochloride) (Standard)		99.75%
  Procaine (hydrochloride) (Standard) is the analytical standard of Procaine (hydrochloride). This product is intended for research and analytical applications. Procaine hydrochloride is a DNA-demethylating agent. Procaine hydrochloride acts through multiple targets and has a slow onset and a short duration of action[1][2].

• HY-121412

  Lankacidin C	Inhibitor
  Lankacidin C is an inhibitor of protein synthesis in vitro. Lankacidin C inhibits the activity of L1210 leukemia, B16 melanoma and 6C3 HED/OG lymphosarcoma cell lines. Lankacidin C has antibacterial activity and antitumor activity[1][2].

• HY-Y0367R

  Maleic Acid (Standard)	Inhibitor
  Maleic Acid (Standard) is the analytical standard of Maleic Acid. This product is intended for research and analytical applications. Maleic Acid is a Glutamate Decarboxylase (GAD) inhibitor of E. coli and L. monocytogenes. IC50 & Target: GAD[1][2]. In Vitro: The MICs of WT 10403S for the acids (e.g., Maleic Acid) are 34 mM, 25 mM, 31 mM and 30 mM which correspond to pH values prior to growth of 4.84, 5.14, 5.32 and 5.02 respectively. Of all compounds tested, Maleic Acid is the least inhibitory despite acting at a lower pH (4.84). The most acid resistant (10403S) and the weakest (EGD-e) strain are challenged with 8.6 mM and 4.3 mM of each organic acid at pH 3 and 3.3 respectively. On both strains, Maleic Acid is the most bactericidal[2].

• HY-N0052A

  Sanguinarine chloride	Inhibitor	98.93%
  Sanguinarine (Sanguinarin) chloride, a benzophenanthridine alkaloid derived from the root of Sanguinaria Canadensis, can stimulate apoptosis via activating the production of reactive oxygen species (ROS). Sanguinarine-induced apoptosis is associated with the activation of JNK and NF-κB.

• HY-W099540

  OES2-0017	Inhibitor
  OES2-0017 shows potent synergy with polyamines and growth-inhibitory effects at the low micromolar range. OES2-0017 inhibits spermine/spermidine acetyltransferase (SpeG) (IC50: 34.82 μM ) and other polyamine detoxification enzymes in low concentrations, perturbed the bacterial membrane in higher concentrations[1].

• HY-P2092

  Cyclo(L-leucyl-L-tryptophyl)	Inhibitor
  Cyclo(L-leucyl-L-tryptophyl) (Cyclo(-Leu-Trp)) is a cyclic dipeptide that inhibits a various of bacteria and fungi. Cyclo(L-leucyl-L-tryptophyl) is a melatonin receptor agonist and is also used as a bitter ligand[1][2][3].

• HY-N0987

  1,4,6-Trihydroxy-5-methoxy-7-prenylxanthone	Inhibitor
  1,4, 6-trihydroxy-5-methoxy-7-prenylxanthone is an antimicrobial agent that can be isolated from the genus garcinia. 1,4, 6-trihydroxy-5-methoxy-7-prenylxanthone inhibits S. aureus and B. cereus with MIC values of 128 μg/mL and 200 μg/mL, respectively[1].

• HY-B0454

  Miconazole	Inhibitor	99.85%
  Miconazole (R18134) is an imidazole antifungal agent. Miconazole also has antibacterial effects[2].

• HY-N9096

  Gentiside B
  Gentiside B has neuritogenic activity and induce neurite outgrowth. Gentiside B can be isolated from the root and rhizome of Gentiana rigescens. Gentiana has hepatoprotective, anti-inflammatory, analgesic, antiproliferative and antimicrobial effects[1][2][3].

• HY-B2060A

  Tiamulin fumarate	Inhibitor
  Tiamulin (Thiamutilin) fumarate is a diterpenic antibiotic that is widely used in pigs and poultry for the control of infectious diseases. Tiamulin fumarate is effectively used in the study of airsacculitis, which is primarily caused by Mycoplasma spp[1].

• HY-150726

  ODN 1668	Inhibitor
  ODN 1668, a class B CpG ODN (oligodeoxynucleotide), is a TLR-9 agonist. ODN 1668 has strong immune regulatory properties, can enhance the level of antibody IgG2 subtype, promote the immune response of T cells and B cells, and can be used in the study of vaccine adjuvants. In addition, CpG ODN 1668 induces an antimicrobial immune response via a CaTLR9 dependent pathway in groupers. Sequence: 5'-tccatgacgttcctgatgct-3’[1][2][3][4].

• HY-N9357

  Granilin	Inhibitor	99.85%
  Granilin, a sesquiterpene lactone, can be found in the flower buds of Carpesium triste. Granilin can be used as the bactericide and fungicide[1].

• HY-B0930

  Efloxate	Inhibitor	99.73%
  Efloxate (Angorlisin) is a vasodilator used in the research of chronic coronary insufficiency and angina pectoris. Efloxate binds to Staphylococcus aureus sortase A[1].

• HY-B1290S2

  2-Phenylethanol-d5
  2-Phenylethanol-d5 is the deuterium labeled 2-Phenylethanol[1]. 2-Phenylethanol (Phenethyl alcohol), extracted from rose, carnation, hyacinth, Aleppo pine, orange blossom and other organisms, is a colourless liquid. It has a pleasant floral odor and also an autoantibiotic produced by the fungus Candida albicans[2]. It is used as an additive in cigarettes and also used as a preservative in soaps due to its stability in basic conditions.

• HY-N0207R

  Patchouli alcohol (Standard)	Inhibitor
  Patchouli alcohol (Standard) is the analytical standard of Patchouli alcohol. This product is intended for research and analytical applications. Patchouli alcohol is a natural tricyclic sesquiterpene, exhibits anti-Helicobacter pylori, anti-inflammatory and antioxidant properties[1].

• HY-130369

  NSC10010 hydrochloride	Inhibitor
  NSC10010 hydrochloride inhibits gammaherpesvirus associated B-lymphomas growth through activation of NF-kB and c-Myc-mediated signaling pathways. NSC10010 hydrochloride induces necrotic cell death in gammaherpesvirus infected B-cells. NSC10010 hydrochloride is also an inhibitor of Mtb ClpC1 ATPase[1][2].

• HY-B0529

  Azlocillin	Inhibitor
  Azlocillin, an antibiotic, is a semisynthetic penicillin, and has broad-spectrum antibacterial activity. Azlocillin is active against drug-tolerant B. burgdorferi sensu stricto JLB31 infection[1][2].

• HY-14655

  Sulfasalazine	Inhibitor	99.04%
  Sulfasalazine (NSC 667219) is an anti-rheumatic agent for the research of rheumatoid arthritis and ulcerative colitis. Sulfasalazine can suppress NF-κB activity. Sulfasalazine is a type 1 ferroptosis inducer[1][2][3][4].

• HY-170876

  UX4O	Inhibitor
  UX4O is an allosteric inhibitor of UDP-glucose dehydrogenase UGDH. hUGDH is a hexamer that can catalyze the oxidation of UDP-glucose to UDP-glucuronic acid. hUGDH has an active (E) state and an inactive (E惟) state, and it needs to bind to the allosteric inhibitor UDP-xylose (UDP-Xyl) to be stabilized in the inactive state. And UX4O may also be a physiologically relevant inhibitor of allosteric UGDH in bacteria that do not produce UDP-Xyl[1].

• HY-P5565

  RP-1	Inhibitor
  RP-1 is an antimicrobial peptide, and is active against S. aureus, S. typhimurium, E. coli, and C. albicans[1].

• HY-N0129R

  Sclareolide (Standard)	Inhibitor

• HY-P1940

  Maculosin	Inhibitor	99.59%
  Maculosin (Cyclo (Tyr-Pro)) is a host-specific phytotoxin for spotted knapweed from Alternaria alternata. Maculosin is a quorum-sensing molecule involved in cell-cell communication. Maculosin also acts as a signaling molecule regulating virulence gene expression. Maculosin shows antimicrobial, antifungal, antioxidant and anti-cancer properties[1][2][3][4][5][6][7][8][9].Maculosin (Cyclo (Tyr-Pro)) is a host-specific phytotoxin for spotted knapweed from Alternaria alternata. Maculosin is a quorum-sensing molecule involved in cell-cell communication. Maculosin also acts as a signaling molecule regulating virulence gene expression. Maculosin shows antimicrobial, antifungal, antioxidant and anti-cancer properties[1][2][3][4][5][6][7][8][9].

• HY-N8015R

  Octanal (Standard)	Inhibitor
  Octanal (Standard) is the analytical standard of Octanal. This product is intended for research and analytical applications. Octanal is a fragrant aldehyde with antioxidant and antibacterial activity. Its antifungal effect against G. citri-aurantii may be related to the disruption of cell membrane integrity and the leakage of cellular components. Additionally, Octanal exhibits cytotoxicity towards HeLa cells, with an IC50 value of 3.5 μg/mL[1][2].

• HY-B0555A

  Nafcillin sodium monohydrate	Inhibitor
  Nafcillin sodium monohydrate, an antibiotic, is a reversible inhibitor of β-lactamase. Nafcillin sodium monohydrate can be used for the research of staphylococcal infections[1][2].

• HY-N1240

  Sissotrin	Inhibitor
  Sissotrin (Biochanin A 7-glucoside) has potent antimicrobial and antioxidant activities. Sissotrin is active against the yeasts and Gram-positive and Gram-negative bacteria with MICs of 32-256 μg/mL[1].

• HY-B0337A

  Sulfadimethoxine sodium	Inhibitor	99.76%
  Sulfadimethoxine sodium (Sulphadimethoxine sodium) is a sulfonamide antibiotic used to treat many infections[1][2].

• HY-122289

  Metioprim	Inhibitor
  Metioprim is a competitive inhibitor of bacterial Dihydrofolate reductase (DHFR). Metioprim has inhibitory activity against anaerobic bacteria. Metioprim shows synergistic activity in combination with DDS (HY-B0688) against E. coli. and various mycobacteria[1][2].

• HY-100760R

  Toxoflavin (Standard)	Inhibitor

• HY-N12763

  Sodium new houttuyfonate	Inhibitor
  Sodium new houttuyfonate (SNH) is a partially reversible NDM-1 inhibitor with an IC50 of 14.2 μM. Sodium new houttuyfonate is an inhibitor against renin and angiotensin I converting enzyme (ACE). Sodium new houttuyfonate can recover the antibacterial activity of Meropenem (HY-13678) against E. coli BL21/pET15b-blaNDM-1[1].

• HY-B0187A

  Doripenem monohydrate	Inhibitor	99.91%
  Doripenem (S 4661) monohydrate, a 1β-methyl parenteral carbapenem, has very broad-spectrum activity against Gram-positive and Gram-negative aerobic bacteria[1][2].

• HY-14860A

  1-Deoxynojirimycin hydrochloride	Inhibitor
  1-Deoxynojirimycin hydrochloride (Duvoglustat hydrochloride) is a potent and orally active α-glucosidase inhibitor. 1-Deoxynojirimycin hydrochloride suppresses postprandial blood glucose and is widely used for diabetes mellitus. 1-Deoxynojirimycin hydrochloride possesses antihyperglycemic, anti-obesity, and antiviral features[1][2].

• HY-105840

  Dichloramine-T	Inhibitor
  Dichloramine-T is a strong oxidizer and disinfectant, with strong oxidation and sterilization. Dichloramine-T is also widely used in the medical and health field for disinfection and sterilization operations[1][2].

• HY-17460B

  Garenoxacin mesylate	Inhibitor
  Garenoxacin (BMS 284756) mesylate is an orally active quinolone antibiotic and Garenoxacin mesylate has a broad spectrum of activity against a wide array of gram-positive and gram-negative bacteria, anaerobes. Garenoxacin mesylate also inhibits Gyrase and TOPO IV[1][2][3][4].

• HY-136429

  Ethylhydrocupreine	Inhibitor
  Ethylhydrocupreine (Optochin) is a quinine derivate with antimicrobial activity against S. pneumoniae. Ethylhydrocupreine also possesses antimalarial activity against Plasmodium falciparum, with an IC50 of 25.75 nM. Ethylhydrocupreine is a Gallus gallus taste 2 receptors (ggTas2r1, ggTas2r2 and ggTas2r7) agonist[1][2][3][4].

• HY-160678

  InhA-IN-7	Inhibitor
  InhA-IN-7 (Compound 11) is a Triclocan (HY-B1119) derivative with inhibitory activity towards enoyl-acyl carrier protein reductase (InhA) with an IC50 of 96 nM. InhA-IN-7 inhibits proliferations of Mycobacterium tuberculosis wildtype and mutant strains with MICs ranging from 19 to 75 μM[1].

• HY-W278232

  Urease-IN-6	Inhibitor	98.89%
  Urease-IN-6 is a potent inhibitor of Urease with an IC50 of 14.2 μM. Urease-IN-6 can be used in study peptic and gastric ulcers [1].

• HY-169104

  InhA-IN-8	Inhibitor
  InhA-IN-8 (compound 6c) is an orally active inhibitor of Mycobacterium tuberculosis InhA (enoyl ACP reductase). InhA-IN-8 has good inhibitory activity against Mtb UalRv (MIC = 0.5-1 μg/mL). InhA-IN-8 can be used in research on acute tuberculosis model mice[1].

• HY-147957

  Antibacterial agent 112	Inhibitor
  Antibacterial agent 112 (compound 2) is a potent antibacterial agent. Antibacterial agent 112 shows antibacterial activity against P.aeruginosa, S.mutans, B.subtilis, E.coli, E.faecalis, S.typhimuriumand, and S.aureus microorganisms, with MIC values of 625, 625, 1250, 1250, 1250, 1250 and 1250 μM, respectively[1].

• HY-N0940

  Batatasin I	Inhibitor
  Batatasin I is a natural product that can be isolated from tuberous roots of Dioscorea batatas, with antifungal activity and anti-inflammatory effects[1].

• HY-N14014

  Arizonin A1	Inhibitor
  Arizonin A1, a microbial metabolite, is an antibiotic with anti-Gram-positive bacterial activities[1].

• HY-B1078R

  Cefazolin (sodium) (Standard)	Inhibitor
  Cefazolin (sodium) (Standard) is the analytical standard of Cefazolin (sodium). This product is intended for research and analytical applications. Cefazolin sodium is a first-generation cephalosporin antibiotic and can be used in varieties of bacterial infections research[1]. Cefazolin sodium has anti-inflammatory effect and can attenuate post-operative cognitive dysfunction (POCD)[2].

• HY-W012037

  8-Hydroxyquinoline hemisulfate	Inhibitor	99.41%
  8-Hydroxyquinoline hemisulfate (8-Quinolinol hemisulfate) is a monoprotic bidentate chelating agent, exhibits antiseptic, disinfectant, and pesticide properties, functioning as a transcription inhibitor.

• HY-N15412

  Cabreuvin
  Cabreuvin is an isoflavonoid compound that can be isolated and extracted from Calopogonium mucunoides. Cabreuvin has a weak inhibitory activity against urease[1].

• HY-B1805S

  Triclocarban-d4	Inhibitor
  Triclocarban-d4 is the deuterium labeled Triclocarban. Triclocarban (3,4,4′-Trichlorocarbanilide), a broad spectrum antibacterial compound, is widely used in a broad range of applications such as the production of soaps, skin creams, toothpastes and deodorants. Triclocarban is a potential endocrine-disrupting chemical with the capacity to modulate androgen and estrogen activities as well as other hormone-mediated biological processes[1][2][3].

• HY-17624A

  Framycetin sulfate	Inhibitor
  Framycetin sulfate (Neomycin B sulfate), an aminoglycoside antibiotic, is a potent RNase P cleavage activity inhibitor with a Ki of 35 μM. Framycetin sulfate competes for specific divalent metal ion binding sites in RNase P RNA. Framycetin sulfate inhibits hammerhead ribozyme with a Ki of 13.5 μM. Framycetin sulfate, a 5″-azido neomycin B precursor, binds the Drosha site in miR-525 and is used for hepatic encephalopathy and enteropathogenic E. coli infections[1][2].

• HY-N0664R

  Aucubin (Standard)	Inhibitor
  Aucubin (Standard) is the analytical standard of Aucubin. This product is intended for research and analytical applications. Aucubin, an iridoid glucoside, is isolated from Plantago asiatica, Eucommia ulmoides, the leaves of Aucuba japonica and more recently from butterfly larva. Aucubin has many biological activities, such as antioxidant, anti-aging, anti-inflammatory, antimicrobial, anti-fibrotic, anti-cancer, hepatoprotective, neuroprotective and osteoprotective effects[1][2][3].

• HY-13777A

  Zoledronic acid monohydrate		99.88%
  Zoledronic acid monohydrate (Zoledronate monohydrate) is a third-generation bisphosphonate (BP), with potent anti-resorptive activity. Zoledronic acid monohydrate inhibits the differentiation and apoptosis of osteoclasts. Zoledronic acid monohydrate also has anti-cancer effects[1].

• HY-W042181S

  N-Decyl-N,N-dimethyldecan-1-aminium-d6 chloride	Inhibitor
  N-Decyl-N,N-dimethyldecan-1-aminium-d6 (chloride) is a deuterated labeled N-Decyl-N,N-dimethyldecan-1-aminium (chloride)[1]. N-Decyl-N,N-dimethyldecan-1-aminium chloride (Didecyldimethylammonium chloride) is a dialkyl-quaternary ammonium compound that is used in numerous products for its bactericidal, virucidal and fungicidal properties[2].

• HY-124789

  TBT1	Inhibitor	99.55%
  TBT1 is a first-generation inhibitor of the MsbA transporter. TBT1 is an LPS transport inhibitor and MsbA ATPase stimulator in strains from the Acinetobacter genus. TBT1 stimulated ATPase activity with an EC50 of 13 µM[1].

• HY-119675

  Albonoursin	Inhibitor
  Albonoursin, a microbial secondary metabolite, is an antibacterial peptide. Albonoursin displays antibacterial and antitumor activities[1].

• HY-B0958A

  Mupirocin calcium	Inhibitor
  Mupirocin (BRL-4910A, Pseudomonic acid) calcium is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin calcium apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2].

• HY-B1454R

  Clindamycin palmitate (hydrochloride) (Standard)	Inhibitor
  Clindamycin palmitate (hydrochloride) (Standard) is the analytical standard of Clindamycin palmitate (hydrochloride). This product is intended for research and analytical applications. Clindamycin palmitate hydrochloride is a hydrochloride salt of the ester of clindamycin and palmitic acid and it is an antibacterial agent. Clindamycin palmitate hydrochloride is inactive in vitro, rapid in vivo hydrolysis converts this compound to the antibacterially active clindamycin[1].

• HY-139747

  Antibacterial agent 32	Inhibitor
  Antibacterial agent 32 (example 43) is an antibacterial agent with MIC values of 1 mcg/mL, 2 mcg/mL, and 8 mcg/mL against E. coli strains NCTC 13351, M 50 and 7 MP, respectively (WO2013030733A1)[1].

• HY-B0536A

  Clinafloxacin hydrochloride	Inhibitor
  Clinafloxacin hydrochloride (AM 1091 hydrochloride) is a potent and broad-spectrum fluoroquinolone antibiotic, has inhibitory activity against gram-positive, gram-negative bacterias, and anaerobic pathogens in vitro[1]. Clinafloxacin hydrochloride is against DNA gyrase and topoisomerase IV of S. aureus with IC50 values of 0.92 µg/ml and 1.62 µg/ml, respectively[2].

• HY-128423R

  Tylvalosin (tartrate) (Standard)	Inhibitor
  Tylvalosin (tartrate) (Standard) is the analytical standard of Tylvalosin (tartrate). This product is intended for research and analytical applications. Tylvalosin (Acetylisovaleryltylosin) tartrate is an orally active, broad-spectrum macrolide antibiotic with antimicrobial activity. Tylvalosin tartrate is an antiviral agent useful in studying PRRSV infection. Tylvalosin tartrate induces apoptosis. Tylvalosin tartrate also has anti-inflammatory activity, relieves oxidative stress, and alleviates acute lung injury by inhibiting NF-κB activation[1][2][3][4].

• HY-145376

  Cholera autoinducer 1
  Cholera autoinducer 1 is Vibrio cholerae autoinducer (S)-3-hydroxytridecan-4-one. Cholera autoinducer 1 influences chemotaxis in C. elegans[1].

• HY-N0538R

  Xylitol (Standard)
  Xylitol (Standard) is the analytical standard of Xylitol. This product is intended for research and analytical applications. Xylitol can be classified as polyols and sugar alcohols.

• HY-139398

  TBI-223	Inhibitor	99.73%
  TBI-223 is an orally bioavailable oxazolidinone antibiotic and an antimicrobial. TBI-223 shows activity against Mycobacterium tuberculosis (Mtb)[1][2].

• HY-141806

  Urease-IN-1	Inhibitor
  Urease-IN-1 is an urease inhibitor with an IC50 value of 2.21 ± 0.45 µM.

• HY-N14909

  Actamycin	Inhibitor
  Actamycin is an ansamycin antibiotic with antibacterial activities[1].

• HY-B0337

  Sulfadimethoxine	Inhibitor	99.80%
  Sulfadimethoxine (Sulphadimethoxine) is a sulfonamide antibiotic used to treat many infections[1][2].

• HY-163269

  MPT	Inhibitor
  MPT is a novel and highly efficient nitrification inhibitor. MPT inhibits ammoniaoxidizing bacteria and archaea[1].

• HY-B1118R

  Secnidazole (Standard)	Inhibitor
  Secnidazole (Standard) is the analytical standard of Secnidazole. This product is intended for research and analytical applications. Secnidazole (RP-14539) is an orally active azole antibiotic and a imidazole mitigator of Serratia marcescens virulence. Secnidazole, as an analog of acylhomoserine lactones, effectively inhibits QS resulting in the attenuation of Pseudomonas aeruginosa pathogenesis. Secnidazole has antimicrobial activity against many anaerobic Gram-negative and Gram-positive bacterial species in vitro. Secnidazole can be used for the research of various diseases, such as amoebiasis and giardiasis, and bacterial vaginitis[1][2][3].

• HY-P10874

  SMR efflux inhibitor	Inhibitor
  SMR efflux inhibitor targets the small multidrug resistance (SMR) efflux pump, blocks the interaction of TM4-TM4, and exhibits board-spectrum antibacterial activity[1].

• HY-169571

  Antimicrobial agent-38	Inhibitor
  Antimicrobial agent-38 (compound 10) is a potent inhibitor of methicillin-resistant S. aureus strain ATCC 700699 and nonresistant strain ATCC 29213, with MICs of 32 and 64 mg/L[1].

• HY-12903R

  Macozinone (Standard)	Inhibitor

• HY-B0210S

  Cefoperazone-d5	Inhibitor	98.58%
  Cefoperazone-d5 is deuterium labeled Cefoperazone. Cefoperazone, a semisynthetic cephalosporin, has a broad spectrum of antibacterial activity[1].

• HY-122448A

  (Rac)-Sativan	Inhibitor
  (Rac)-Sativan is an isoflavanoid with a broad spectrum of antimicrobial activity against bacteria and phytopathogenic fungi. (Rac)-Sativan exhibits antituberculosis activity against Mycobacterium tuberculosis H37Rv, with MIC values of 50 µg/mL[1][2].

• HY-17647

  Zoliflodacin	Inhibitor
  Zoliflodacin (ETX0914;AZD0914) is a novel spiropyrimidinetrione bacterial DNA gyrase/topoisomerase inhibitor. Zoliflodacin has potent in vitro antibacterial activity against Gram-positive and Gram-negative organisms, including S. aureus with the MIC90 of 0.25 μg/mL.

• HY-P1978

  CysHHC10	Inhibitor
  CysHHC10 is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria. The MIC values of CysHHC10 against E. coli, P. aeruginosa, S. aureus and S. epidermidis are 10.1 mM, 20.2 mM, 2.5 mM and 1.3 mM, respectively[1].

• HY-147429

  Zosurabalpin	Inhibitor	99.09%
  Zosurabalpin is a polypeptide antibiotic targeting LPS transporter (LptB2FGC complex), which can block the transport of LPS and lead to endotoxin accumulation in cells, and has shown excellent antibacterial activity against Carbapenem-resistant Acinetobacter baumanni (CRAB) [1] [2].

• HY-N7125S

  Cinnamyl acetate-13C2
  Cinnamyl acetate-13C2 is 13C labeled Nerolidol (HY-N1944). Nerolidol has multiple natural membrane activities, possesses anti-cancer, anti-inflammatory, antibacterial and anti-insect activity. Nerolidol Suppresses parasitic activity, suppresses bloodsucking diseases, bloodworm diseases, and other diseases. Nerolidol can protect the cells from lipid and protein properties, damage to DNA, and protect the cells from damage[1][2][3].

• HY-N8443S

  Isoaltenuene-d6	Inhibitor
  Isoaltenuene-d6 is deuterium labeled Isoaltenuene. Isoaltenuene is an anti-bacterial agent with moderate activity against Staphylococcus aureus. Isoaltenuene can be isolated from fungus Alternaria alternate cib-137[1][2].

• HY-B1008

  4-Aminobenzoic acid	Inhibitor
  4-Aminobenzoic acid is an intermediate in the synthesis of folic acid by bacteria, plants and fungi. 4-Aminobenzoic acid has antibacterial and plant growth regulating properties[1][2][3].

• HY-W104752

  5-(Pyridin-4-yl)-1,3,4-oxadiazole-2-thiol	Inhibitor
  5-(Pyridin-4-yl)-1,3,4-oxadiazole-2-thiol (Compound 3n) is an antimicrobial and antioxidant agent, that inhibits Escherichia coli and Staphylococcus epidermidis, with MIC of 8 and 4 μg/mL. 5-(Pyridin-4-yl)-1,3,4-oxadiazole-2-thiol exhibits antioxidant activity with IC50 of 17.47 μM using DPPH free radical-scavenging method[1].

• HY-161813

  Antibacterial agent 229	Inhibitor
  Antibacterial agent 229 (compound 8a) is a potent antibacterial agent. Antibacterial agent 229 shows antibacterial and antifungal abilities. Antibacterial agent 229 disrupts the integrity of the bacterial membrane, intercalates into DNA. Antibacterial agent 229 inhibits topoisomerase IV with an IC50 value of 10.88 µM[1].

• HY-170991

  C12-rrw-NH2	Inhibitor
  C12-rrw-NH2 (Compound Lip7) is an antibacterial agent against gram-positive bacteria, especially against Methicillin (HY-121544)-resistant Staphylococcus aureus (MRSA). C12-rrw-NH2 induces bacterial death via depolarizing the bacterial cytoplasmic membrane, disrupting the integrity of the bacterial membrane, leading to leakage of nucleic acid and protein and promoting the generation of Reactive Oxygen Species. C12-rrw-NH2 is potential to be used for research of developing high-stability antimicrobial peptides[1].

• HY-B0177R

  Tinidazole (Standard)	Inhibitor
  Tinidazole (Standard) is the analytical standard of Tinidazole. This product is intended for research and analytical applications. Tinidazole, an orally available antibacterial agent, is a 5-nitroimidazole with selective activity against anaerobic bacteria and protozoa[1].

• HY-P3601

  Brain Derived Basic Fibroblast Growth Factor (1-24)	Inhibitor	99.86%
  Brain Derived Basic Fibroblast Growth Factor (1-24) (FGF basic 1-24) is a synthetic peptide, shows anti-bacterial and anti-HBV activities. Brain Derived Basic Fibroblast Growth Factor (1-24) can be used in infection disease and immune disease research[1].

• HY-146593

  Antibacterial agent 88	Inhibitor
  Antibacterial agent 88 (Compound 5h) is a potent antibacterial agent with MIC values of both ≤0.0156 μg/mL against MRSA, MRSE and S. aureus. Antibacterial agent 88 also inhibits B. subtilis with an MIC of 4 μg/mL[1].

• HY-B0535

  Ethambutol	Inhibitor
  Ethambutol is a bacteriostatic antimycobacterial agent, which obstructs the formation of cell wall by inhibiting arabinosyl transferases.

• HY-155460

  Pks13-TE inhibitor 4	Inhibitor
  Pks13-TE inhibitor 4 (compound 44) is an oxadiazole series Pks13 inhibitor that effectively inhibits tuberculosis (TB) and resolves its drug resistance[1].

• HY-D1444

  Propidium monoazide
  Propidium monoazide is a photoreactive DNA-binding dye that preferentially binds to dsDNA. Propidium monoazide (PMA) prevents DNA from dead bacteria from being amplified during the PCR. PMA-PCR enhanced both the specificity and the sensitivity of PCR[1]. Propidium monoazide is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

• HY-B1466

  Mezlocillin sodium	Inhibitor	98.06%
  Mezlocillin (BAY-f 1353) sodium is a β-lactam antibiotic, a semisynthetic and extended-spectrum antibiotic. Mezlocillin sodium is active against both gram-negative and gram-positive bacteria. Mezlocillin sodium can be used in bacterial infection research[1][2].

• HY-B0730R

  Pamidronate (disodium pentahydrate) (Standard)
  Pamidronate (disodium pentahydrate) (Standard) is the analytical standard of Pamidronate (disodium pentahydrate). This product is intended for research and analytical applications.

• HY-N6738

  Bafilomycin B1	Inhibitor	98.22%
  Bafilomycin B1 is a macrolide antibiotic isolated from Streptomyces sp, inhibits Gram-positive bacteria and fungi, and acts as an inhibitor of K+-dependent ATPase of E. coli[1].

• HY-125416

  Streptothricin F	Inhibitor
  Streptothricin F is a bactericidal antibiotic. Streptothricin F interacts with the 30S subunit of 70S ribosome. Streptothricin F shows rapid, bactericidal activity against highly drug-resistant, carbapenem-resistant Enterobacterales (CRE) (MIC50 and MIC90: 2 and 4 μM, respectively) and Acinetobacter baumannii[1].

• HY-152534

  MenA-IN-2	Inhibitor	99.84%
  MenA-IN-2 (Compound 11) is an inhibitor of 1,4-dihydroxy-2-naphthoate prenyltransferase (MenA). MenA-IN-2 inhibits MenA with an IC50 value of 22 µM and inhibits Mycobacterium tuberculosis (Mtb) with an GIC50 value of 10 µM. MenA-IN-2 can curb the continuous transmission of Mtb[1].

• HY-155230

  T3SS-IN-2
  T3SS-IN-2 (Compound 2h) is a type three secretion system (T3SS) inhibitor. T3SS-IN-2 can be used for bacterial infection research[1].

• HY-127075

  Alahopcin	Inhibitor
  Alahopcin is a dipeptide antibiotic with a broad antibacterial spectrum[1].

• HY-14648A

  Dexamethasone acetate	Inhibitor	99.84%
  Dexamethasone acetate (Dexamethasone 21-acetate) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

• HY-125455

  Ro 41-1879	Inhibitor
  Ro 41-1879 is a catechol cephalosporin that has antimicrobial activity[1].

• HY-20349

  Monobehenin	Inhibitor
  Monobehenin, an bacterial biofilm formation inhibitor, has strong inhibitory activity toward bacterial biofilm formation of S. mutans, X. oryzae, and Y. enterocolitica in a strain specific manner[1].

• HY-112702

  CRS400393	Inhibitor
  CRS400393 is a potent antimycobacterial agent, with MIC of 0.03, 2, and ≤ 0.12 µg/mL against M. abs., M. avium, M. intracellulare, and M. tuberculosis, respectively[1].

• HY-163191

  NDM-1 inhibitor-5	Inhibitor
  NDM-1 inhibitor-5 (compound 57) is a potent NDM-1 inhibitor, with a Ki of 2.5 μM. NDM-1 inhibitor-5 also shows antibacterial synergistic activity with meropenem (HY-13678)[1].

• HY-112959

  Telavancin
  Telavancin (TD-6424) is a semisynthetic lipoglycopeptide vancomycin-derivative, is a novel antimicrobial agent developed by Theravance for overcoming resistant Gram-positive bacterial infections, specifically methicillin-resistant Staphylococcus aureus (MRSA). Telavancin disrupts cell membrane integrity, can be used for research of complicated skin and skin structure infections (cSSSIs) caused by Gram-positive bacteria[1].

• HY-151459

  VEGFR-2/DHFR-IN-2	Inhibitor
  VEGFR-2/DHFR-IN-2 (compound 5b) is an inhibitor of VEGFR-2 and DHFR with IC50s of 0.623 and 9.085 μM, respectively. VEGFR-2/DHFR-IN-2 exhibits good cytotoxic activities against C26, HepG2, and MCF7 cancer cell lines with IC50 values of 3.59-8.38 μM. VEGFR-2/DHFR-IN-2 can be used for the research of cancer[1].

• HY-131048

  Antimicrobial agent-33	Inhibitor
  Antimicrobial agent-33 (Compound 2b) is an antimicrobial agent, with MIC values of 2-64 μg/mL. Antimicrobial agent-33 is an active compound against Staph. Aureus[1].

• HY-B1802A

  Tosufloxacin tosylate hydrate	Inhibitor	99.95%
  Tosufloxacin tosylate hydrate (A-61827) is an orally active fluoroquinolone antibiotic. Tosufloxacin shows a broad spectrum of antibacterial activity against gram-positive and gram-negative bacteria[1][2].

• HY-B0522AR

  Ampicillin (sodium) (Standard)	Inhibitor
  Ampicillin (sodium) (Standard) is the analytical standard of Ampicillin (sodium). This product is intended for research and analytical applications. Ampicillin sodium (D-(-)-α-Aminobenzylpenicillin sodium salt) is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria[1].

• HY-146450

  PXYC2	Inhibitor
  PXYC2 is a ribosomal protein S1 (RpsA) antagonist with Kds of 6.35 and 5.11 μM for RpsA-CTD and RpsA-CTD Δ438A, respectively. RpsA plays an important role in the trans-translation process of Mycobacterium Tuberculosis (Mtb)[1].

• HY-103251

  PF-5081090	Inhibitor	99.88%
  PF-5081090 (LpxC-4) is a potent LpxC inhibitor, is a rapidly bactericidal with broad-spectrum activity. PF-5081090 serves as a regulator of lipid A biosynthesis in Gram-negative pathogens[1][2].

• HY-146488

  Anti-infective agent 2	Inhibitor
  Anti-infective agent 2 (compound 3k) shows antiparasitic activity against P. falciparum and T. brucei rhodesiense, with IC50 values of 0.07 and 2.20 μM, respectively. Anti-infective agent 2 shows antimycobacterial activity against Mycobacterium smegmatis with a MIC of 32 μg/mL[1].

• HY-149353

  Antibacterial agent 145	Inhibitor
  Antibacterial agent 145 (compound 1b) is an antibacterial agent depending on bacterial iron uptake pathway. Antibacterial agent 145 disrupts cytoplasmic membrane integrity and inhibits cell metabolism but exhibits low cytotoxic effects to normal cells[1].

• HY-146447

  PXYC13	Inhibitor
  PXYC13 is a ribosomal protein S1 (RpsA) antagonist with Kds of 7.61 and 8.50 μM for RpsA-CTD and RpsA-CTD Δ438A, respectively. RpsA plays an important role in the trans-translation process of Mycobacterium Tuberculosis (Mtb)[1].

• HY-Y1093S2

  Ethyl acetoacetate-d5		99.22%
  Ethyl acetoacetate-d5 is the deuterium labeled Ethyl acetoacetate[1]. Ethyl acetoacetate (Ethyl acetylacetate) is an ester widely used as an intermediate in the synthesis of many varieties of compounds[2][3][4]. Ethyl acetoacetate is an inhibitor of bacterial biofilm[5].

• HY-P10684

  Polyphemusin II	Inhibitor
  Polyphemusin II is an antimicrobial peptide which can be isolated from Limulus polyphemus hemocytes. Polyphemusin II exhibits antimicrobial activities against various Gram (+)/(-) bacteria and fungi[1].

• HY-151403

  Antimicrobial agent-9	Inhibitor
  Antimicrobial agent-9 (Compound 16) is an antimicrobial agent with an MIC range of 4-8 μg/mL against gram-positive and gram-negative bacteria. Antimicrobial agent-9 also shows anti-inflammatory activity[1].

• HY-N1347R

  Robinetin (Standard)	Inhibitor
  Robinetin (Standard) is the analytical standard of Robinetin. This product is intended for research and analytical applications. Robinetin (3,3',4',5',7-Pentahydroxyflavone), a naturally occurring flavonoid with remarkable ‘two color’ intrinsic fluorescence properties, has antifungal, antiviral, antibacterial, antimutagenesis, and antioxidant activity. Robinetin also can inhibit lipid peroxidation and protein glycosylation[1][2][3][4][5].

• HY-106789

  Plaunotol
  Plaunotol is an orally active acyclic diterpene alcohol. Plaunotol has antibacterial activity against Helicobacter pylori which causes peptic ulcer [1]. Plaunotol inhibits tumor angiogenesis and cell proliferation. Plaunotol induces apoptosis by activation of caspase 8 and caspase 9 pathways. Plaunotol is a potential anticancer agent against colon cancer [2].

• HY-17560

  Demeclocycline hydrochloride	Inhibitor
  Demeclocycline hydrochloride is a tetracycline antibiotic, which is found in a mutant strain of Streptomyces aureofaciens. Demeclocycline hydrochloride is promising for research of Lyme disease, acne, chronic inappropriate antidiuretic hormone secretion and bronchitis[1][2][3][4][5].

• HY-129952

  Dihydropleuromutilin
  Dihydropleuromutilin is a reduced product of Pleuromutilin, which is active against gram-positive bacteria and shows lower toxicity[1].

• HY-B0593R

  Ceftazidime (Standard)	Inhibitor
  Ceftazidime (Standard) is the analytical standard of Ceftazidime. This product is intended for research and analytical applications. Ceftazidime (GR20263), an antibiotic, has a broad spectrum activity against Gram-positive and Gram-negative aerobic bacteria. Ceftazidime is also active against Enterobacteriaceae (including β-lactamase-positive strains) and is resistant to hydrolysis by most β-lactamases[1].

• HY-19748

  LED209	Inhibitor	98.87%
  LED209 is a potent and orally active small molecule inhibitor of the bacterial receptor QseC and a potent prodrug with high selectivity for QseC. LED209 inhibits the binding of signaling molecules to QseC. LED209 has antibacterial activity[1].

• HY-105674

  Azidamfenicol	Inhibitor
  Azidamfenicol is a broad-spectrum chloramphenicol-like antibiotic. Azidamfenicol inhibits ribosomal peptidyltransferase (Ki=22 μM)[1]. Azidamfenicol is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

• HY-163342

  Antibacterial agent 190	Inhibitor
  Antibacterial agent 190 (compound 16) is a antibacterial agent. Antibacterial agent 190 shows antibacterial activity. Antibacterial agent 190 reduces the bacterial burden of the peritoneum and blood[1].

• HY-P5655

  Maximin H4	Inhibitor
  Maximin H4 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H4 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 12, 6, 12, 6 μg/ml, respectively[1].

• HY-W004263

  1-Eicosanol	Inhibitor
  1-Eicosanol is a natural compound with antioxidant activity isolated from Hypericum carinatum[1].

• HY-B0334AS1

  Sulbactam-d2 sodium
  Sulbactam-d2 (sodium) is the deuterium labeled Sulbactam sodium[1]. Sulbactam (CP45899) sodium is a competitive, irreversible beta-lactamase inhibitor. Sulbactam sodium shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus--Acinetobacter baumannii (Acb) complex[2][3].

• HY-118205

  SCH-538415	Inhibitor
  SCH-538415 is a novel acyl carrier protein synthase inhibitor isolated from an unknown bacterial microorganism. The structural elucidation of compound 1 was completed by analyzing spectral data including UV, MS and 2D-NMR spectra. Compound 1 showed inhibitory activity in the acyl carrier protein synthase (AcpS) test with an IC50 value of 4.19 μM and exhibited antibacterial activity against Staphylococcus aureus in the agar diffusion test.

• HY-P5687

  Im5	Inhibitor
  Im5, an antimicrobial peptide, has antibacterial (MIC: 10, 2.5-5, 0.5-1 μM for E. coli, S. aureus, B. subtilis respectively) and hemolytic activity (EC50: 28 μM)[1].

• HY-U00035R

  MGB-BP-3 (Standard)	Inhibitor
  Sinapine (thiocyanate) (Standard) is the analytical standard of Sinapine (thiocyanate). This product is intended for research and analytical applications. Sinapine thiocyanate is an alkaloid isolated from seeds of the cruciferous species. Sinapine thiocyanate exhibits anti-inflammatory, anti-oxidant, anti-tumor, anti-angiogenic and radio-protective effects. Sinapine thiocyanate is also an acetylcholinesterase (AChE) inhibitor and can be used for the research of Alzheimer’s disease, ataxia, myasthenia gravis, and Parkinson’s disease[1][2][3][4].

• HY-17580

  Fidaxomicin	Inhibitor	99.85%
  Fidaxomicin (OPT-80), a macrocyclic antibiotic, is an orally active and potent RNA polymerase inhibitor. Fidaxomicin has a narrow spectrum of antibacterial activity and a good anti-Clostridium difficile activity (MIC90=0.12 μg/mL). Fidaxomicin can be used for Clostridium difficile infection (CDI) research[1][2][3].

• HY-168511

  DNA Gyrase-IN-13	Inhibitor
  DNA Gyrase-IN-13 (compound 1b) is a DNA Gyrase inhibitor. DNA Gyrase-IN-13 has antibacterial activity. DNA Gyrase-IN-13 has an IC50 value of 1.81 μM for Staphylococcus aureus DNA gyrase[1].

• HY-117657

  (-)-BO 2367	Inhibitor
  (-)-BO 2367, an antimicrobial quinolone, is a strong mammalian and bacterial topoisomerase II inhibitor. (-)-BO 2367 shows IC50 values with 3.8 μM, 0.5 μM, and 1 μM against the DNA relaxation activity of L1210 topoisomerase II and the supercoiling activities of Escherichia coli gyrase and Micrococcus luteus gyrase, respectively. (-)-BO 2367 is a potent antitumor agent[1].

• HY-155546

  Antimicrobial agent-22	Inhibitor
  Antimicrobial agent-22 (THI 6c) is a multi-target broad-spectrum antibacterial agent. Antimicrobial agent-22 has low cytotoxicity, hemolytic property, rapid bactericidal ability and good anti-biofilm activity[1].

• HY-162113

  Antibacterial agent 174	Inhibitor
  Antibacterial agent 174 (Compound 5g) is a antibacterial agent. Antibacterial agent 174 has potent anti-infective potential in vivo and appreciable pharmacokinetic profiles. Highly active antibacterial agent 174 has favorable biofilm removal performance, low hemolysis and acceptable mammalian cell toxicity[1].

• HY-P5685

  Maximin 49	Inhibitor
  Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells[1].

• HY-Y1878C

  Copper sulfate anhydrous, 99%	Inhibitor	99.65%
  Anhydrous copper sulfate, 99% (Cupric sulfate anhydrous, 99%) is an orally administerable disinfectant. Anhydrous copper sulfate, 99% can be used as a biomaterial or organic compound related to life sciences research, and it can increase the Cu content in rat organs[1][2].

• HY-N3139

  Ombuin	Inhibitor	98.96%
  Ombuin, isolated from Zanthoxylum armatum, displays broad spectrum antibacterial effect with MIC ranges from 125 to 500 μg/mL[1].

• HY-119123A

  Voxvoganan trihydrochloride	Inhibitor	98.13%
  Voxvoganan (LTX-109) trihydrochloride, a topical antimicrobial, is highly effective against S. aureus with a MIC range of 2 to 4 μg/mL. Voxvoganan trihydrochloride can be used for the research of bacterial skin infections, fungal infections and nasal decolonisation of MRSA[1][2].

• HY-125620

  Rubiginone D2	Inhibitor
  Rubiginone D2 is an antibiotic, which exhibits antimicrobial activities against Bacillus subtilis, Staphylococcus aureus and Escherichia coli. Rubiginone D2 exhibits antitumor efficacy, inhibits proliferations of cancer cells HM02, Kato III, HepG2 and MCF7, with GI50s of 0.1, 0.7, <0.1 and 7.5 μM, respectively[1].

• HY-149810

  AcrB-IN-2	Inhibitor
  AcrB-IN-2 is an AcrB efflux pump inhibitor, with ability to potentiate the effect of antibiotics. AcrB-IN-22 inhibits Nile Red (a known substrate of AcrB) efflux.AcrB-IN-2 does not disrupts the bacterial outer membrane nor display toxicity in a nematode model[1].

• HY-12459

  Pyrindamycin B	Inhibitor
  Pyrindamycin B is an antibiotic, actives against gram-positive and gram-negative bacterias, and exhibits strong therapeutic effects against both agent-sensitive and resistant cells of P388 leukemia in mice[1].

• HY-116039

  Epiroprim	Inhibitor
  Epiroprim (Ro11-8958) is a selective dihydrofolate reductase (DHFR) inhibitor. Epiroprim displays excellent activity against staphylococci, enterococci, pneumococci, and streptococci[1].

• HY-100528

  Nanchangmycin	Inhibitor
  Nanchangmycin, a polyether antibiotic produced by Streptomyces nanchangensis NS3226, inhibits gram-positive bacteria[1]. Nanchangmycin is a broad spectrum antiviral active against Zika virus[2].

• HY-156191

  Cholic acid anilide	Inhibitor
  Cholic acid anilide, a Narylcholan-24-amide, is a potent inhibitor of C. difficile spore germination with an IC50 value of 1.8 μM in the spore germination assay conducted in Sodium phosphate media containing 6 mM Taurocholate (HY-B1131) and 12 mM Glycine (HY-Y0966). Cholic acid anilide has the potential for C. difficile infections research[1].

• HY-B1852

  Sulfometuron-methyl	Inhibitor
  Sulfometuron-methyl is a herbicide and also a powerful inhibitor of the enzyme acetolactate synthase (ALS). It exhibits antibacterial and antifungal activities, capable of inhibiting the activity of Salmonella. typhimurium ALS II and Escherichia. coli ALS III[1].

• HY-N13267

  (-)-cis-Myrtanol	Inhibitor
  (-)-cis-Myrtanol is a terpenoid compound derived from Artemisia dracunculus that exhibits effective antibacterial activity against harmful gut bacteria such as Bifidobacterium bifidum[1][2].

• HY-111396

  PC58538	Inhibitor
  PC58538 is a cell division inhibitor, targeting to FtsZ. PC58538 shows moderate antibacterial activity, and inhibits cell division in vegetative cells of wild-type B. subtilis. PC58538 is also known to modulate the rate of GTP hydrolysis[1][2].

• HY-W995025A

  Actinobolin hemisulfate	Inhibitor
  Actinobolin hemisulfate ((+)-Actinobolin hemisulfate) is the hemisulfate form of Actinobolin (HY-W995025). Actinobolin hemisulfate is an antibiotic, that inhibits protein synthesis by targeting bacterial and eukaryotic ribosomes. Actinobolin hemisulfate inhibits Mycobacterium smegmatis, Escherichia coli and rabbit reticulocyte lysate (RRL) with an IC50 of 19.2, 27.9, and 288 μmol/L, respectively[1].

• HY-N4052A

  (±)-Heraclenol	Inhibitor
  (±)-Heraclenol, a coumarin, is isolated from the fruits of Angelica lucida, and exhibits antibacterial activities[1].

• HY-N1160

  Tetrahydroxysqualene	Inhibitor
  Tetrahydroxysqualene is a triterpene, possessing antimycobacterial activity against Mycobacterium tuberculosis with an MIC of 10.0 μg/mL. Tetrahydroxysqualene can be isolated from the methanolic extracts of Rhus taitensis Guill[1].

• HY-169105

  DNA Gyrase-IN-12	Inhibitor
  DNA Gyrase-IN-12 (Compound 6d) is a DNA gyrase inhibitor. DNA Gyrase-IN-12 has Antibacterial activity and MIC value of vancomycin-intermediate S. aureus (VISA) and Enterococcus faecalis strains is between 0.031 and 0.0625 μg/mL[1].

• HY-P2202

  Desferriferribactin
  Desferriferribactin is a cyclic peptide containing a thirteen-membered ring. Desferriferribactin is a precursor of pyoverdins[1].

• HY-149395

  MmpL3-IN-3	Inhibitor
  MmpL3-IN-3 (Compound 12) is a MmpL3 inhibitor. MmpL3-IN-3 shows a MIC of 0.1 μM against H37Rv. MmpL3-IN-3 shows good stability in mouse liver microsomes. MmpL3-IN-3 can be used for anti-tubercular research[1].

• HY-121021

  BB-78485	Inhibitor
  BB-78485 is an LpxC metalloenzyme inhibitor with antibacterial activity. BB-78485 can inhibit LpxC with an IC50 value of 160 nM. BB-78485 can be used for the research of gram-negative selective antibacterials[1].

• HY-W653970

  5-Azacytidine-15N4	Inhibitor
  5-Azacytidine-15N4 is 13C and 15N labeled 5-Azacytidine. 5-Azacytidine (Azacitidine; 5-AzaC; Ladakamycin) is a nucleoside analogue of cytidine that specifically inhibits DNA methylation. 5-Azacytidine is incorporated into DNA to covalently trap DNA methyltransferases and contributes to reverse epigenetic changes. 5-Azacytidine induces cell autophagy[1][2][3][4].

• HY-B0129R

  Aztreonam (Standard)	Inhibitor
  Aztreonam (Standard) is the analytical standard of Aztreonam. This product is intended for research and analytical applications. Aztreonam (SQ-26,776) is a synthetic monocyclic beta-lactam antibiotic, which has a very high affinity for penicillin-binding protein 3 (PBP-3).

• HY-146652

  UGM-IN-3	Inhibitor
  UGM-IN-3 (compound 10a) is a UDP-galactopyranose mutase (UGM) inhibitor with a Kd of 66 μM. UGM-IN-3 inhibits the growth of Mycobacterium tuberculosis with a MIC value of 6.2 μg/mL[1].

• HY-N10230

  MC 304
  MC 304 is a β-resorcylate isolated from cultures of Phanerochaete chrysosporium. MC 304 has antibacterial activity. MC 304 shows a stimulatory effect on root elongation of Lepidium satiuum[1].

• HY-B0097

  Floxuridine	Inhibitor
  Floxuridine (5-Fluorouracil 2'-deoxyriboside) is a pyrimidine analog and known as an oncology antimetabolite. Floxuridine inhibits Poly(ADP-Ribose) polymerase and induces DNA damage by activating the ATM and ATR checkpoint signaling pathways in vitro. Floxuridine is a extreamly potent inhibitor for S. aureus infection and induces cell apoptosis[1][2]. Floxuridine has antiviral effects against HSV and CMV[3].

• HY-122467

  Kumbicin C
  Kumbicin C is a bis-indolyl benzenoid compound from an Australian soil fungus, Aspergillus kumbius. Kumbicin C inhibits the growth of mouse myeloma cells and the Gram-positive bacterium Bacillus subtilis[1].

• HY-N0339

  Syringic acid	Inhibitor
  Syringic acid is correlated with high antioxidant activity and inhibition of LDL oxidation.

• HY-13588

  Cefsulodin sodium	Inhibitor
  Cefsulodin (SCE-129) sodium is a third generation β lactam antibiotic and member of the cephems subgroup of antibiotics. Cefsulodin sodium inhibits cell wall synthesis by competitively inhibiting penicillin binding protein (PBP) cross-linking and transpeptidation of peptidogly. Cefsulodin sodium is a potent tyrosine phosphatase inhibitor against mPTPB, a virulent phosphatase from Mycobacterium tuberculosis, with an IC50 value of 16 μM[1][2][3][4].

• HY-145455

  Salazopyridazine	Inhibitor
  Salazopyridazine is an antibacterial agent. Salazopyridazine shows activities against ulcerative colitis. Salazopyridazine can be used for the research of rheumatic diseases[1][2].

• HY-P5657

  Maximin H5
  Maximin H5 is an antimicrobial peptide derived from toad Bombina maxima[1].

• HY-170367

  Antimicrobial agent-35	Inhibitor
  Antimicrobial agent-35 (Compound c9) exhibits antibacterial agent, that inhibits S. aureus, E. coli, E. faecalis, and S. maltophilia with MIC of 0.5-2 μg/mL. Antimicrobial agent-35 exhibits cytotoxicity against HT-22 with IC50 of 130.4 μg/mL[1].

• HY-W014612

  Eugenol acetate	Inhibitor	99.76%
  Eugenol acetate (Eugenyl acetate) is an antibacterial, anticancer, anti-inflammatory and antioxidant. Eugenol acetate inhibits NF-κB and enhances the expression of p53 and p21 (WAF1). Eugenol acetate can prevent chemically induced skin cancer, inhibit cancer cell proliferation and induce apoptosis[1][2][3][4].

• HY-B0972

  Cinchophen	Inhibitor	99.97%
  Cinchophen is a potent and orally active non-steroidal anti-inflammatory agent, has analgesic and antimicrobial effects. Cinchophen can be used for the research of arthritis and some liver diseases[1].

• HY-N3300

  Mellein
  Mellein is an antibiotic isolated from culture fluids of this Aspergillus[1].

• HY-P5548

  CaLL	Inhibitor
  CaLL is an antimicrobial peptide. CaLL has antibacterial activity against B. anthracis, B. anthracis (vegetative), and B. cepacia (MIC: 7.8, 31.3, 31.3 μg/mL)[1].

• HY-W005327R

  1-Hydroxy-2-butanone (Standard)	Inhibitor

• HY-100941

  CCCP	Inhibitor	99.83%
  CCCP is an oxidative phosphorylation (OXPHOS) uncoupler. CCCP induces activation of PINK1 leading to Parkin Ser65 phosphorylation[1].

• HY-N13917

  Argyrin B	Inhibitor
  Argyrin B, a natural product cyclic peptide, is a reversible, non-competitive immunoproteasome inhibitor. Argyrin B shows selective inhibition of the β5i and β1i sites of the immunoproteasome over the β5c and β1c sites of the constitutive proteasome with nearly 20-fold selective inhibition of β1i over the homologous β1c. Argyrin B has antibacterial effects[1].

• HY-B1252

  Cefalonium	Inhibitor
  Cefalonium is the first-generation β-lactam cephalosporin antibiotic that is widely used to research bovine mastitis caused by Gram-positive bacteria including staphylococci[1][2][3].

• HY-143236

  DHFR-IN-1	Inhibitor
  DHFR-IN-1 (compound 12) is a potent and selective DHFR (dihydrofolate reductase)inhibitor, with an IC50 of 40.71 nM. DHFR-IN-1 exhibits promising antibacterial activity against gram-positive and gram-negative bacteria. DHFR-IN-1 exhibits moderate antifungal activities. DHFR-IN-1 exhibits a high synergistic effect with Levofloxacin (HY-B0330), where the FIC (fractional inhibitory concentration index) value is 0.249[1].

• HY-P1698

  Reltecimod	Inhibitor	99.88%
  Reltecimod (AB-103) is a T-cell-specific surface glycoprotein CD28 (TP44) antagonist. Reltecimod has beneficial effects against different bacterial infections, their exotoxins and endotoxins, and ionizing radiation. Reltecimod modulates the inflammatory response by targeting and attenuating the critical CD28/B7-2 co-stimulatory pathway, without inhibiting it. Reltecimod can be used to research necrotizing soft-tissue infections (NSTIs)[1][2].

• HY-B0226R

  Nitrofurazone (Standard)	Inhibitor
  Nitrofurazone (Standard) is the analytical standard of Nitrofurazone. This product is intended for research and analytical applications. Nitrofurazone (Nitrofural) is a broad spectrum antibiotic that has oral activity. Nitrofurazone is a nitro-aromatic drug. Nitrofurazone is active against both Gram-positive and Gram-negative bacteria[1][2][3][4][5].

• HY-122073

  Furalazine	Inhibitor
  Furalazine is an antimicrobial agent. Furalazine shows activity against drug-resistant strains of cholera bacteria. Furalazine has the potential for the research of cholera[1].

• HY-19285AR

  Sulfaclozine (sodium) (Standard)	Inhibitor
  Sulfaclozine (sodium) (Standard) is the analytical standard of Sulfaclozine (sodium). This product is intended for research and analytical applications. Sulfaclozine sodium (Sulfachloropyrazine sodium) is an efficacious sulphonamide derivative with antibacterial and anticoccidial effects. Sulfaclozine sodium is commonly used for the treatment of various poultry diseases (particularly, collibacteriosis, fowl cholera and coccidiosis)[1].

• HY-127093

  Sedecamycin	Inhibitor
  Sedecamycin is an antibiotic, which exhibits antibacterial activity against gram-positive bacteria. Sedecamycin inhibits Treponema hyodysenteriae, with MIC of 0.78 to 12.5 µg/ml. Sedecamycin exhibits protective and therapeutic effect against the swine dysentery in mouse models[1].

• HY-W015591S

  Mandelic acid-2,3,4,5,6-d5	Inhibitor
  Mandelic acid-2,3,4,5,6-d5 is the deuterium labeled Mandelic acid. Mandelic acid ((±)-Mandelic acid), an alpha-hydroxycarboxylic acid, has been widely used as an intermediate of pharmaceutical and fine chemicals. Mandelic acid shows antimicrobial activity and has been used for the research of urinary tract infections and vaginal trichomoniasis. Mandelic acid exhibits high sperm-immobilizing activity and low vaginal irritation[1][2].

• HY-B1149AR

  Bacampicillin (hydrochloride) (Standard)	Inhibitor
  Bacampicillin (hydrochloride) (Standard) is the analytical standard of Bacampicillin (hydrochloride). This product is intended for research and analytical applications.

• HY-120383

  Amicetin	Inhibitor
  Amicetin is a potent antibiotic. Amicetin shows antibiotic activities against gram-positive bacteria. Amicetin inhibits protein synthesis[1][2][3].

• HY-B1747A

  Pyrithione sodium	Inhibitor
  Pyrithione sodium has poor skin penetration.

• HY-B1290

  2-Phenylethanol	Inhibitor	99.91%
  2-Phenylethanol (Phenethyl alcohol) is an aromatic alcohol with a rose-like odour. 2-Phenylethanol is a flavour and fragrance compound, and can be used as a preservative and anti-microbial agent. 2-Phenylethanol has antityrosinase and antimicrobial activities[1][2].

• HY-N4117

  Hamamelitannin	Inhibitor	99.43%
  Hamamelitannin, a polyphenol extracted from the bark of Hamamelis virginiana, is a quorum-sensing (QS) inhibitor. Hamamelitannin increases antibiotic susceptibility of staphylococcus aureus biofilms by affecting peptidoglycan biosynthesis and eDNA release[1][2].

• HY-N8301

  Ilicicolin F
  Ilicicolin F is a fungal metabolite that has been found in Fusarium and has diverse biological activities. It inhibits T. vivax alternative oxidase and the E. coli ubiquinol oxidase cytochrome bo (IC50s=0.43 and 0.37 μM, respectively) but not the E. coli ubiquinol oxidase cytochrome bd (IC50=85 μM).2 Ilicicolin F is active against the fungi A. fumigatus and C. albicans (MICs=1.66-3.33 and 6.66-13.33 μg/mL, respectively). It is cytotoxic to HeLa cells with an EC50 value of 0.003 μg/mL.

• HY-107833

  A40926	Inhibitor
  A40926, the precursor of Dalbavancin, is a second-generation glycopeptide antibiotic. A40926 inhibits gram-positive bacteria, and is very active against Neisseria gonorrhoeae[1].

• HY-142695

  Antibacterial synergist 1
  Antibacterial synergist 1 (compound 20P) is a bacterial biofilm inhibitor. Antibacterial synergist 1 inhibits the production of pyocyanin and biofilm formation with IC50s of 8.6 and 4.5 μM, respectively. Antibacterial synergist 1 has the potential for the research of P. aeruginosa infections[1].

• HY-B0732

  Itopride hydrochloride		99.84%
  Itopride (HSR803) hydrochloride is a potent dopamine-2 antagonist and an acetylcholine esterase (AChE) inhibitor. Itopride hydrochloride enhances gastric motility through both antidopaminergic and anti-acetylcholinesterasic actions, can be used as a gastrointestinal prokinetic agent. Itopride can be used for researching gastro-esophageal reflux disease (GERD)[1][2].

• HY-D1005A4

  Poloxamer 122 (L42)	Inhibitor
  Poloxamer 122 L42 is block polymer of polyoxyethylene and polyoxypropylene with average molecular mass of 1630. Poloxamer 122 L42 exhibits antimicrobial activity, that inihibits 56% Mycobacterium avium complex at concentration of 1 mg/mL. Poloxamer 122 L42 forms thermoreversible hydrogel, that is utilized in food additives, drug delivery carriers in cosmetics, pharmaceutical ingredients and tissue engineering[1][2].

• HY-119901

  Eupatarone	Inhibitor
  Eupatarone (Caleprunin B) is a bacterial inhibitor. Eupatarone can be obtained from Calea platylepis[1].

• HY-P10257

  KR-12 (human)	Inhibitor	99.88%
  KR-12 human is an active segment of LL-37, which exhibits antimicrobial activity against gram-negative bacteria. KR-12 human inhibits E. coli K-12 with MIC of 66 μM[1].

• HY-N7515

  Pinocembrin chalcone	Inhibitor
  Pinocembrin chalcone (2',4',6'-Trihydroxychalcone) is an antibacterial compound from Helichrysum Trilineatum. Pinocembrin chalcone facilitates AMP-activated protein kinase (AMPK) activation, improves glucose tolerance, increases muscle FAO and reduces fat accumulation in the liver and skeletal muscles in high-fat diet-induced (HFD) diabetic mice. Pinocembrin chalcone is promising for research of gastric ulcers and diabetes[1][2].

• HY-E70518

  Oxalate decarboxylase, Microorganism
  Oxalate decarboxylase, Microorganism (EC 4.1.1.2), a stress-response enzyme in certain soil bacteria, is a Mn-dependent enzyme in the cupin superfamily and is found in fungi and soil bacteria. Oxalate decarboxylase catalyzes the decarboxylation of the oxalate mono-anion in the soil bacterium Bacillus subtilis. Enzymatic activity of OxDC is strongly pH dependent, with a maximum at around pH 4.0[1].

• HY-12326

  c-di-AMP		99.29%
  c-di-AMP (Cyclic diadenylate) is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP (Cyclic diadenylate) is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP (Cyclic diadenylate) acts as a potent mucosal adjuvant stimulating both humoral and cellular responses[1][2][3][4].

• HY-B0105

  Ketoconazole		99.51%
  Ketoconazole (R-41400) is an imidazole anti-fungal agent, a CYP3A4 and CYP24A1 inhibitor.

• HY-17574

  Thio-TEPA	Inhibitor
  Thio-TEPA is a DNA alkylating agent, with antitumor activity.

• HY-P2767

  Urease, Jack bean
  Urease, Jack bean is derived from jack bean and Catalyzes hydrolysis of urea to carbon dioxide and ammonia. Urease, Jack bean is useful in the determination of urea in body fluids.

• HY-161264

  Antiviral agent 49	Inhibitor
  Antiviral agent 49 (compound 4q) is dual antiviral and antibacterial agent. Antiviral agent 49 shows anti-enterococcus activity and anti-staphylococcal activity[1].

• HY-133726

  Bixafen	Inhibitor
  Bixafen, a member of the pyrazole class of fungicides, serves as a broad-spectrum agent for controlling pathogens in cereal crops by functioning as a succinate dehydrogenase inhibitor.

• HY-106597AR

  Pirlimycin hydrochloride (Standard)	Inhibitor
  Pirlimycin (hydrochloride) (Standard) is the analytical standard of Pirlimycin (hydrochloride). This product is intended for research and analytical applications. Pirlimycin hydrochloride, a lincosamide antibiotic, is active against Gram-positive bacteria. Pirlimycin hydrochloride acts by inhibiting bacterial protein synthesis via binding with the 50S subunit of the ribosome[1].

• HY-P10721

  Plectasin	Inhibitor
  Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice[1].

• HY-136382S

  Sulfachloropyridazine-d4	Inhibitor
  Sulfachloropyridazine-d4 is the deuterium labeled Sulfachloropyridazine. Sulfachloropyridazine is a broad spectrum sulfonamide used against both Gram-positive and Gram-negative aerobic bacteria[1].

• HY-N0056R

  Isochlorogenic acid A (Standard)	Inhibitor
  Isochlorogenic acid A (Standard) is the analytical standard of Isochlorogenic acid A. This product is intended for research and analytical applications. Isochlorogenic acid A (3,5-Dicaffeoylquinic acid) is a natural phenolic acid with anti-mutagenicity, anti-HBV, anti-HIV, anti-oxidant, anti-bacterial, and anti-inflammatoryy activities[1].

• HY-N14052

  Arizonin C3	Inhibitor
  Arizonin C3 is a microbial metabolite with anti-Gram-positive bacterial activities[1].

• HY-B1831AR

  Oritavancin (diphosphate) (Standard)	Inhibitor
  Oritavancin (diphosphate) (Standard) is the analytical standard of Oritavancin (diphosphate). Oritavancin diphosphate (Standard), a semisynthetic derivative of Vancomycin (HY-B0671), is an orally active glycopeptide antibiotic with bactericidal activity against gram-positive organisms. Oritavancin diphosphate (Standard) shows antibacterial effect against B. anthracis, such as Ames strain with a MIC value of 0.015 g/mL. Oritavancin diphosphate (Standard) inhibits cell wall synthesis and disrupts the membrane potential. Oritavancin diphosphate (Standard) inhibits ArlS kinase activity thereby interfering the signal transduction. Oritavancin diphosphate (Standard) enters cells by adsorptive endocytosis, which drives it to lysosomes, where it exerts antibiotic activity[1][2][3][4][5].

• HY-P99447

  Atidortoxumab	Inhibitor
  Atidortoxumab is a human IgG1κ monoclonal antibody that targets Staph aureus alpha toxin[1].

• HY-B2006R

  Fenvalerate (Standard)	Inhibitor
  Fenvalerate (Standard) is the analytical standard of Fenvalerate. This product is intended for research and analytical applications. Fenvalerate is a potent protein phosphatase 2B (calcineurin) inhibitor with an IC50 of 2-4 nM for PP2B-Aα. Fenvalerate is a pyrethroid ester insecticide and acaricide[1].

• HY-168461

  AK-968-11563024
  AK-968-11563024 is an inhibitor of marine V. vulnificus NAT [ (VIBVN)NAT] with an IC50 of 18.86 µM. NATs (Arylamine N-acetyltransferases) in marine V. vulnificus plays a role in drug metabolism, contributing to the development of drug resistance. Therefore, AK-968-11563024 can be utilized in research related to drug resistance[1].

• HY-P6011

  GMPRGA	Inhibitor
  GMPRGA, derived from the phages Spbeta, can recognize spAimR in the bacterial cytosol to induce lysogeny[1].

• HY-B1118

  Secnidazole	Inhibitor	99.87%
  Secnidazole (RP-14539) is an orally active azole antibiotic and a imidazole mitigator of Serratia marcescens virulence. Secnidazole, as an analog of acylhomoserine lactones, effectively inhibits QS resulting in the attenuation of Pseudomonas aeruginosa pathogenesis. Secnidazole has antimicrobial activity against many anaerobic Gram-negative and Gram-positive bacterial species in vitro. Secnidazole can be used for the research of various diseases, such as amoebiasis and giardiasis, and bacterial vaginitis[1][2][3].

• HY-156753

  NorA-IN-1	Inhibitor
  NorA-IN-1 (Compound 16) is a NorA inhibitor. NorA-IN-1 inhibits NorA efflux pump in everted membrane vesicles. NorA-IN-1 can be used for research of multidrug resistance[1].

• HY-B1828A

  Spectinomycin dihydrochloride pentahydrate	Inhibitor
  Spectinomycin dihydrochloride pentahydrate is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin dihydrochloride pentahydrate acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin dihydrochloride pentahydrate is also a noncompetitive inhibitor of td intron RNA with an Ki value of 7.2 mM[1]-[5].

• HY-B1431S1

  Butylparaben-13C6
  Butylparaben-13C6 is the 13C labeled Butylparaben[1]. Butylparaben is an organic compound, has proven to be a highly successful antimicrobial preservative in cosmetics, also used in medication suspensions, and as a flavoring additive in food.

• HY-N10561

  Wychimicin A	Inhibitor
  Wychimicin A is a spirotetronate polyketide, can be isolated from the rare actinomycete Actinocrispum wychmicini strain MI503-AF4. Wychimicin A shows strong antibacterial activity against methicillin-resistant Staphylococcus. aureus (IC50=0.125-0.5 μg/mL) and Enterococcus. faecalis/faecium (IC50=0.125-0.25 μg/mL)[1][2].

• HY-169521

  DNA Gyrase-IN-16	Inhibitor
  DNA Gyrase-IN-16 (Compound 9) is the inhibitor for DNA gyrase with an IC50 of 1.609 μM. DNA Gyrase-IN-16 exhibits antibacterial activity, inhibits S. aureus and MRSA with MIC of 3.125 μM and 3.125 μM[1].

• HY-N0717

  L-Valine	Inhibitor
  L-Valine (Valine) is a new nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase[1][2][3].

• HY-150983

  ATP synthase inhibitor 2	Inhibitor	99.93%
  ATP synthase inhibitor 2 is a Pseudomonas aeruginosa (PA) ATP synthase inhibitor (IC50=10 μg/mL). ATP synthase inhibitor 2 can inhibit Pseudomonas aeruginosa (PA) ATP synthesis activity completely at 128 μg/mL[1].

• HY-B1145R

  Chlorhexidine (dihydrochloride) (Standard)	Inhibitor
  Chlorhexidine (dihydrochloride) (Standard) is the analytical standard of Chlorhexidine (dihydrochloride). This product is intended for research and analytical applications. Chlorhexidine dihydrochloride is an orally active antimicrobial agent. Chlorhexidine dihydrochloride can damage the bacteria cell wall, inhibit proliferation of S. sobrinus and induce DNA damage[1][2][3].

• HY-152252

  Antibacterial agent 133	Inhibitor
  Antibacterial agent 133 (4l) is an antimicrobial agent that has shown anti-Candida activity, particularly through LMD enzyme inhibition. Antibacterial agent 133 shows MIC90 values of 1.95 μg/mL against Candida albicans ATCC 24433, Candida smoothis ATCC 90030 and Candida subtilis ATCC 22019[1].

• HY-N0704

  Agrimol B	Inhibitor
  Agrimol B, a polyphenol, is an orally active and potent SIRT1 activator. Agrimol B shows anti-adipogenic and anticancer activity. Agrimol B shows antibacterial activity against plant pathogens. Agrimol B dramatically inhibits 3T3-L1 adipocyte differentiation by reducing PPARγ, C/EBPα, FAS, UCP-1, and apoE expression. The action of Agrimol B on the cancer cells is likely derived from its effect on c-MYC, SKP2 and p27[1][2][3].

• HY-12395

  Ecteinascidin-Analog-1
  Ecteinascidin-Analog-1 is a useful intermediate for chemical sythesis of Ecteinascidin analogues; Ecteinascidins is a family of tetrahydroisoquinoline alkaloids with wide range of antitumor and antimicrobial activities.

• HY-N7151R

  Aurachin D (Standard)	Inhibitor
  Kasugamycin (hydrochloride) (Standard) is the analytical standard of Kasugamycin (hydrochloride). This product is intended for research and analytical applications. Kasugamycin hydrochloride (Ksg hydrochloride) is an antibiotic which binds both the 30S and 70S ribosome but not isolated 50S subunits. Kasugamycin hydrochloride (Ksg hydrochloride) mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation[1][2].

• HY-P5684

  Maximin H39	Inhibitor
  Maximin H39 is an antimicrobial peptide. MaximinH39 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 9.4, 9.4, 18.8 μg/mL). Maximin H39 has hemolytic activities against human and rabbit red cells[1].

• HY-130004

  MsbA-IN-6
  MsbA-IN-6 is a potent inhibitor of MsbA. MsbA-IN-6 is an antibiotic. Gram-negative ATP-binding cassette (ABC) transporter MsbA, an essential inner membrane protein, transports lipopolysaccharide from the inner leaflet to the periplasmic face of the inner membrane. MsbA-IN-6 kills Escherichia coli through inhibition of its ATPase and transport activity, with no loss of activity against clinical multidrug-resistant strains[1][2].

• HY-N6027

  Cyclosporin C	Inhibitor	99.96%
  Cyclosporin C is a fungal metabolite that has been found in T. inflatum and has diverse biological activities, including antifungal, antiviral, and immunosuppressant properties. Cyclosporin C is active against isolates of B. cinerea, A. niger, and Alternaria, Mucor, and Penicillium species (MICs=0.1-5 μg/ml).

• HY-147531

  Antibacterial agent 106	Inhibitor
  Antibacterial agent 106 (compound 8) is an orally active and potent antibacterial agent with antibiofilm activity. Antibacterial agent 106 shows potent antibacterial effect against multi-agent resistant (MDR)-Gram positive pathogens. Antibacterial agent 106 is highly effective in clearing 99.7% of the intracellular methicillin-resistant S. aureus (MRSA) harbored inside macrophages[1]. Antibacterial agent 106 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-124334

  L-161240	Inhibitor
  L-161240 is an antibiotic, which exhibits antibacterial activity against Escherichia coli, through inhibition of LpxC enzyme (Ki is 50 nM)[1].

• HY-123716

  Rubradirin B	Inhibitor
  Rubradirin B is an antibiotic, which inhibits a variety of Gram-positive bacteria and Haemophilus influenza. Rubradirin B affects the ribosome functions[1].

• HY-N8306

  Isojacareubin	Inhibitor
  Isojacareubin can be isolated from Hypericum japonicum. Isojacareubin covalently inhibits SARS-CoV-2 3CLpro. Isojacareubin also has anti-helicobacter activity. Isojacareubin inhibits PKC, and suppresses hepatocellular carcinoma metastasis and induces apoptosis[1][2][3].

• HY-161279

  Antibiofilm agent-5	Inhibitor
  Antibiofilm agent-5 (compound 6c) is a multitargeting antibacterial agent with potent antibiofilm activity. Antibiofilm agent-5 could induce metabolic dysfunction by deactivating lactate dehydrogenase and promote the accumulation of reactive oxygen species to decrease the reduced glutathione and ultimately cause oxidative damage in bacteria. Antibiofilm agent-5 can be used for the research of refractory biofilm-intensified bacterial infections[1].

• HY-17507R

  Pantoprazole (Standard)
  Pantoprazole (Standard) is the analytical standard of Pantoprazole. This product is intended for research and analytical applications. Pantoprazole (BY10232) is an orally active and potent proton pump inhibitor (PPI)[1]. Pantoprazole, a substituted benzimidazole, is a potent H+/K+-ATPase inhibitor with an IC50 of 6.8 μM. Pantoprazole improves pH stability and has anti-secretory, anti-ulcer activities. Pantoprazole significantly increased tumor growth delay combined with Doxorubicin (HY-15142)[3][4].

• HY-14648S2

  Dexamethasone-d4	Inhibitor
  Dexamethasone-d4 is deuterium labeled Dexamethasone. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

• HY-136439

  4-Epianhydrotetracycline hydrochloride	Inhibitor
  4-Epianhydrotetracycline hydrochloride is a major intermediate product of Tetracycline (HY-A0107). 4-Epianhydrotetracycline hydrochloride shows lethal effects and induces cell apoptosis of zebrafish embryos. 4-Epianhydrotetracycline hydrochloride inhibits Shewanella, E. coli and P. aeruginosa with MIC values of 2, 1 and 64 mg/L, respectively[1].

• HY-119166

  3,5,4'-Tribromosalicylanilide	Inhibitor
  3,5,4'-Tribromosalicylanilide is a compound with antituberculosis and anti-Mycobacterium abscessus activities, which was found to inhibit the growth of Mycobacterium tuberculosis and Mycobacterium abscessus and affect gene expression by computational compound repositioning approach.

• HY-119353

  Repromicin	Inhibitor
  Repromicin is an antibacterial agent that inhibits P. multocida 56A006 with MIC value of 0.39 μg/mL[1].

• HY-N6748

  Roquefortine C	Inhibitor
  Roquefortine C, a fungal cyclopeptide isolated from Penicillium roquefortii, activates P-gp and also inhibits P450-3A and other haemoproteins. Roquefortine C has bacteriostatic activities against Gram-positive bacteria[1].

• HY-N7784

  Liriodenine methiodide	Inhibitor
  Liriodenine methiodide is an antibiotic that is active against C. albicans and S. cereuisiae with antimicrobial activities[1][2].

• HY-W719074

  Sulfisomidin-d4	Inhibitor
  Sulfisomidin-d4 (Sulfaisodimidine-d4) is deuterium labeled Sulfisomidin. Sulfisomidin (Sulfaisodimidine) is an orally active short-acting sulfonamide antibacterial. Sulfisomidin can be used for the research of lower urinary tract infections[1][2].

• HY-P1546

  Bombinin-Like Peptide (BLP-1)	Inhibitor
  Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.

• HY-A0086R

  Netilmicin (sulfate) (Standard)	Inhibitor
  Netilmicin (sulfate) (Standard) is the analytical standard of Netilmicin (sulfate). This product is intended for research and analytical applications. Netilmicin (sulfate) (SCH-20569 (sulfate)) is an active aminoglycoside antibiotic against most Gram-negative and some Gram-positive bacteria, including certain strains resistant to gentamicin.

• HY-118099R

  Florfenicol amine (hydrochloride) (Standard)	Inhibitor

• HY-B0467B

  Amoxicillin trihydrate	Inhibitor
  Amoxicillin (Amoxycillin) trihydrateis an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin trihydrateis inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth[1][2][3].

• HY-162775

  TST1N-224	Inhibitor
  TST1N-224 is a potent response regulator VraRC inhibitor. TST1N-224 can disrupt VraRC-DNA complex formation (IC50=60.2 μM). TST1N-224 exhibits interference with VraRC binding to its cognate DNA through a fast-on-fast-off binding mechanism (KD=23.4 μM). TST1N-224 predominantly interacts with the α9- and α10-helixes of the DNA-binding domain of VraR. TST1N-224 inhibits the growths of S. aureus (SA; MIC>126 μM), Methicillin-resistant S. aureus (MRSA; MIC>126 μM), and Vancomycin-intermediate S. aureus (VISA; MIC=63 μM). TST1N-224, an antimicrobial agent, evidently enhances the susceptibility of VISA to both Vancomycin (HY-B0671) and Methicillin (HY-B0974)[1].

• HY-W752582R

  Cortisol-1,2-d2 (Standard)	Inhibitor
  Cortisol-1,2-d2 (Standard) is the analytical standard of Cortisol-1,2-d2. This product is intended for research and analytical applications. Cortisol-1,2-d2 is the deuterium labeled Cortisol[1].

• HY-N0662

  Amentoflavone	Inhibitor	99.81%
  Amentoflavone (Didemethyl-ginkgetin) is a potent and orally active GABA(A) negative modulator. Amentoflavone also shows anti-inflammatory, antioxidative, anti-viral, anti-tumor, anti-radiation, anti-fungal, antibacterial activity. Amentoflavone induces apoptosis and cell cycle arrest at sub-G1 phase[1][2][3][4].

• HY-B1211R

  Dehydroacetic acid (Standard)	Inhibitor
  Dehydroacetic acid (Standard) is the analytical standard of Dehydroacetic acid. This product is intended for research and analytical applications. Dehydroacetic acid (Biocide 470F), a pyrone derivative acts as an antibacterial and antifungal agent. Dehydroacetic acid possess phytotoxic activity[1].

• HY-B0101R

  Fluconazole (Standard)
  Fluconazole (Standard) is the analytical standard of Fluconazole. This product is intended for research and analytical applications. Fluconazole (UK-49858) is a triazole antifungal agent with excellent activities against a broad range of fungi, especially against Candida albicans. Fluconazole inhibits C. albicans and Candida kefyr with IC99s range from 0.20 μg/mL to 0.39 μg/mL[1].

• HY-125388

  Martinomycin	Inhibitor
  Martinomycin is an antibiotic, which inhibits Staphylococcus spp., Streptococcus spp. and Enterococcus spp., with MICs ranging from 0.06 to 0.5 μg/mL[1].

• HY-N1394S

  p-Anisic acid-13C6	Inhibitor
  p-Anisic acid-13C6 is the 13C-labeled p-Anisic acid. p-Anisic acid (4-Methoxybenzoic acid) is one of the isomers of anisic acid, with anti-bacterial and antiseptic properties[1].

• HY-157438

  pppApA	Inhibitor
  pppApA is a linear dinucleotide intermediate in the enzymatic production of the bacterial signalling nucleotide c-diAMP. pppApA is formed by conjugation between two molecules of ATP[1].

• HY-B2006S1

  Fenvalerate-d6	Inhibitor
  Fenvalerate-d6 is the deuterium-labeled Fenvalerate (HY-B2006)[1].

• HY-B0239S3

  Chloramphenicol-d4	Inhibitor
  Chloramphenicol-d4 is deuterium labeled Chloramphenicol. Chloramphenicol, a broad-spectrum antibiotic, acts as a potent inhibitor of bacterial protein biosynthesis[1][2]. Chloramphenicol acts primarily on the 50S subunit of bacterial 70S rihosomes and inhibits peptide bond formation by suppressing peptidyl transferase activity[3].

• HY-B1002S

  Oxolinic acid-d5	Inhibitor	98.0%
  Oxolinic acid-d5 is the deuterium labeled Oxolinic acid. Oxolinic acid is an antibiotic against both Gram-negative and Gram-positive bacteria. Oxolinic acid can be used for the research of acute and chronic urinary tract infections. Oxolinic acid is a DNA/RNA synthesis inhibitor. Oxolinic acid acts a dopamine uptake inhibitor and stimulants locomotor effect in mice[1][2][3].

• HY-A0088

  Cefotaxime sodium	Inhibitor	99.25%
  Cefotaxime (Cefotaxim) sodium, a β-lactamase stable cephalosporin and a third-generation cephalosporin antibiotic, possesses broad-spectrum antibiotic activity against numerous Gram-positive and Gram-negative bacteria[1][2][3][4][5].

• HY-149479

  Quorum sensing-IN-3	Inhibitor
  Quorum sensing-IN-3 (Compound 3a) is a quorum sensing inhibitor against pseudomonas aeruginosa. Quorum sensing-IN-3 inhibits biofilm formation[1].

• HY-P2523

  Temporin L	Inhibitor	99.85%
  Temporin L is a potent antimicrobial peptide and is active against Gram-negative bacteria and yeast strains. Temporin L also has antiendotoxin properties[1][2].

• HY-139761

  Antibacterial agent 44	Inhibitor
  Antibacterial agent 44 is an antibacterial agent extracted from patent WO2013030735A1, example 7. Antibacterial agent 44 can be used for the research of bacterial infections[1].

• HY-N15029

  Destomycin A	Inhibitor
  Destomycin A is an aminoglycoside antibiotic with antibacterial (Gram-positive bacteria, Gram-negative bacteria), antifungal and anthelmintic activities. Destomycin A inhibits the polypeptide synthesis in cells of Escherichia coli and stimulation of adenylate cyclase in animal tissues[1][2].

• HY-P1508A

  Bactenecin TFA	Inhibitor	98.42%
  Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei[1][2][3].

• HY-N7074

  Lanolin
  Lanolin is a yellow fat obtained from sheep's wool. Lanolin is used topically for sore, cracked nipples during breastfeeding[1].

• HY-138185

  Collismycin A
  Collismycin A is a bacterial metabolite originally isolated from Streptomyces that has diverse biological activities, including antibacterial, antiproliferative, and neuroprotective properties. It is active against a variety of bacteria (MICs=6.25 and 100 μg/mL) and fungi (MICs=12.5-100 μg/mL). It inhibits proliferation of A549 lung, HCT116 colon, and HeLa cervical cancer cells (IC50s=0.3, 0.6, and 0.3 μM, respectively) and NIH373 fibroblasts (IC50=56.6 μM) but not MDA-MD-231 breast cancer cells (IC50=>100 μM). Collismycin A forms a complex with Fe(II) and Fe(III) at a 2:1 ratio, and the addition of iron ions inhibits the antiproliferative effect of collismycin A on HeLa cells, an effect that does not occur with the addition of zinc, manganese, copper, or magnesium ions.3 Collismycin A (1 μM) prevents apoptosis in the brain region of zebrafish larvae in a model of neuronal cell death induced by all-trans retinoic acid.

• HY-B1390BR

  Saccharin (sodium hydrate) (Standard)	Inhibitor
  Saccharin (sodium hydrate) (Standard) is the analytical standard of Saccharin (sodium hydrate). This product is intended for research and analytical applications. Saccharin sodium hydrate is an orally active, non-caloric artificial sweeteners (NAS). Saccharin sodium hydrate has bacteriostatic and microbiome-modulating properties[1].

• HY-N6807

  Elemicin	Inhibitor	99.22%
  Elemicin is an orally active alkenylbenzene widely distributed in many herbs and spices. Elemicin inhibits Stearoyl-CoA Desaturase 1 (SCD1) by metabolic activation. Elemicin has anti-influenza activities, antimicrobial, antioxidant, and antiviral activities. Elemicin and its reactive metabolite of 1′-Hydroxyelemicin can induce hepatotoxicity[1][2][3][4].

• HY-B0274AS

  Chlorprothixene-d6 hydrochloride	Inhibitor
  Chlorprothixene-d6 (hydrochloride) is the deuterium labeled Chlorprothixene hydrochloride. Chlorprothixene hydrochloride is a dopamine and histamine receptors antagonist with Kis of 18 nM, 2.96 nM, 4.56 nM, 9 nM and 3.75 nM for hD1, hD2, hD3, hD5 and hH1 receptors, respectively. Antipsychotic activity[1].

• HY-B0466A

  Cloxacillin	Inhibitor
  Cloxacillin is an orally active antibacterial agent and β-lactamase inhibitor with an IC50 of 0.04 μM. Cloxacillin can suppress the S. aureus-induced inflammatory response by inhibiting the activation of MAPKs, NF-кB and NLRP3-related proteins[1][2][3].

• HY-B0875

  Cefmenoxime hydrochloride	Inhibitor	99.29%
  Cefmenoxime (SCE-1365) hydrochloride is a new semisynthetic cephalosporin antibiotic. Cefmenoxime has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria[1][2].

• HY-129252

  Prothracarcin	Inhibitor
  Prothracarcin is an antibiotic with antitumor activity that exerts its tumor cell toxicity by covalently binding to the C-2 amino group of guanine residues in the minor groove of DNA. Prothracarcin also shows antibacterial activity against Gram-positive bacteria and some Gram-negative bacteria such as Escherichia coli[1].

• HY-N2150

  Psammaplin A	Inhibitor
  Psammaplin A, a marine metabolite, is a potent inhibitor of HDAC and DNA methyltransferases. Psammaplin A ia a highly potent and selective DAC1 inhibitor with an IC50 of 0.9 nM. Psammaplin A possess the antimicrobial effect on the Gram-positive bacteria and inhibits DNA synthesis and DNA gyrase activity. Antitumor Activity[1][2].

• HY-N4136R

  Lonicerin (Standard)	Inhibitor
  Lonicerin (Standard) is the analytical standard of Lonicerin. This product is intended for research and analytical applications. Lonicerin is an anti-algE (alginate secretion protein) flavonoid with inhibitory activity for P. aeruginosa. Lonicerin prevents inflammation and apoptosis in LPS-induced acute lung injury[1][2].

• HY-168486

  Biotin protein ligase-IN-1	Inhibitor
  Biotin protein ligase-IN-1 (Compound Bio-9) is an inhibitor of biotin protein ligase (BPL) with a Kd value of 7 nM. Biotin protein ligase-IN-1 exhibits antibacterial activity, with MIC values of 0.2 and 20 μM against Staphylococcus aureus (including MRSA and MSSA) and Mycobacterium tuberculosis, respectively[1].

• HY-17508S

  Clarithromycin-13C,d3
  Clarithromycin-13C,d3 is the deuterium and 13C labeled Clarithromycin[1].

• HY-146470

  Antibacterial agent 103	Inhibitor
  Antibacterial agent 103 (compound 7) has highly antibacterial activity against kinds of Gram-positive and -negative bacteria. Antibacterial agent 103 can be used for researching inhibition of resistance bacterial strains[1].

• HY-N0626

  Sorbic acid	Inhibitor	99.98%
  Sorbic acid is an effective, safe, and non-toxic food preservative. It can effectively inhibit most molds, yeasts, and certain bacteria. Sorbic acid is orally active and can enhance the growth performance of economically important animals (Duroc × Landrace × Yorkshire piglets) by activating the insulin-like growth factor system (IGF), and it can also lead to lipid accumulation by disrupting lipid clearance pathways[1][2][3][4]。

• HY-W006449

  PNU-105368	Inhibitor
  PNU-105368 is a compound with antibacterial activity and a metabolite of linezolid. It exists mainly in the form of the original form and two metabolites in the human body and is excreted through the kidneys and feces.

• HY-B0323C

  Sulfisoxazole 100 µg/mL in methanol
  Sulfisoxazole 100 μg/mL in methanol (Sulfafurazole 100 μg/mL in methanol) is a sulfonamide antimicrobial compound.

• HY-101867

  AU1235	Inhibitor	99.90%
  AU1235, an adamantyl urea, is a potent MmpL3 inhibitor. The Mycobacterium tuberculosis protein MmpL3 performs an essential role in cell wall synthesis, since it effects the transport of trehalose monomycolates across the inner membrane[1][2].

• HY-B1252BR

  Cefalonium (dihydrate) (Standard)	Inhibitor
  Cefalonium (dihydrate) (Standard) is the analytical standard of Cefalonium (dihydrate). This product is intended for research and analytical applications. Cefalonium dihydrate is a cephalosporin antibiotic. Cefalonium (dihydrate) is effective against Staphylococcus aureus. Cefalonium (dihydrate) has anti-inflammatory and antibacterial activities[1].

• HY-B1466A

  Mezlocillin	Inhibitor
  Mezlocillin (BAY-f 1353) is a β-lactam antibiotic, a semisynthetic and extended-spectrum antibiotic. Mezlocillin is active against both gram-negative and gram-positive bacteria. Mezlocillin can be used in bacterial infection research[1][2].

• HY-126387

  Moenomycin complex
  Moenomycin complex is a potent transglycosylase inhibitor. Moenomycin complex inhibits bacterial growth by blocking the transglycosylase activity of class A penicillin-binding proteins (PBPs)[1].

• HY-N5169

  Argimicin C	Inhibitor
  Argimicin C is an antibiotic that can be isolated from Sphingomonas sp.. Argimicin C exhibits algicidal activity against a variety of toxic cyanobacteria with MIC of low micromolar levels[1].

• HY-W011517

  2-Fluoroadenosine	Inhibitor
  2-Fluoroadenosine (2FA) is a nucleoside analogue. 2-Fluoroadenosine has antibacterial activity with IC50 value of 0.842 mM for Vibrio microvibrio[1].

• HY-18702

  Targocil	Inhibitor	98.84%
  Targocil functions as a bacteriostatic inhibitor of wall teichoic acid (WTA) biosynthesis which can inhibit the growth of methicillin-susceptible S. aureus (MSSA) and methicillin-resistant S. aureus (MRSA) with MIC90s of 2 μg/ mL for both MRSA and MSSA.

• HY-B0425

  Novobiocin	Inhibitor
  Novobiocin (Albamycin) is a potent and orally active antibiotic. Novobiocin also is a DNA gyrase inhibitor and a heat shock protein 90 (Hsp90) antagonist. Novobiocin has the potential for the research of highly beta-lactam-resistant pneumococcal infections. Novobiocin shows anti-orthopoxvirus activity[1][2][3][4][6].

• HY-17412A

  Minocycline	Inhibitor
  Minocycline is an orally active, potent and BBB-penetrated semi-synthetic tetracycline antibiotic. Minocycline is a hypoxia-inducible factor (HIF)-1α inhibitor. Minocycline shows anti-cancer, anti-inflammatory, and glutamate antagonist effects. Minocycline reduces glutamate neurotransmission and shows neuroprotective properties and antidepressant effects. Minocycline inhibits bacterial protein synthesis through binding with the 30S subunit of the bacterial ribosome, resulting in a bacteriostatic effect[1][2][3][4][5][6][7].

• HY-B0501R

  Danofloxacin (mesylate) (Standard)	Inhibitor
  Danofloxacin mesylate (Standard) is the analytical standard of Danofloxacin mesylate. This product is intended for research and analytical applications. Danofloxacin mesylate (CP 76136-27) is a fluoroquinolone used as a veterinary drug. Danofloxacin mesylate has a broad spectrum of bactericidal activity, mainly inhibiting the DNA cycloenzyme of the bacteria. In addition, Danofloxacin mesylate is a substrate for ATP-dependent efflux transporters (P-gp and MRP2)[1][2].

• HY-125130

  Hesperetin 7-O-glucoside	Inhibitor	98.08%
  Hesperetin 7-O-glucoside is a typical flavonoid monoglucoside, which is an anti-inflammatory agent and an antihypertensive with orally active. Hesperetin 7-O-glucoside is a commonly used food adjuvant. Hesperetin 7-O-glucoside inhibits human intestinal maltase and human HMG-CoA reductase with Ki of 1.8 mM and 9.8 μM, respectively. Hesperetin 7-O-glucoside has antibacterial activity and can regulate intestinal flora and metabolic homeostasis in mice[1][2][3].

• HY-145877

  Antibacterial agent 79	Inhibitor
  Antibacterial agent 79 (compound 32) is an antibacterial agent[1].

• HY-158193

  N-Decanoyl cyclopentylamide	Inhibitor
  N-Decanoyl cyclopentylamide (C10-CPA) is a potent inhibitor of quorum sensing in Pseudomonas aeruginosa. N-Decanoyl cyclopentylamide interferes with expression of Pseudomonas aeruginosa virulence factors regulated by the las and rhl quorum-sensing systems. N-Decanoyl cyclopentylamide inhibits production of elastase, pyocyanin, and rhamnolipid and biofilm formation[1].

• HY-W017401R

  Benzisothiazolone (Standard)	Inhibitor
  Benzisothiazolone (Standard) is the analytical standard of Benzisothiazolone. This product is intended for research and analytical applications. Benzisothiazolone is an isothiazolone fungicide. Benzisothiazolone has growth inhibiting activity against E. coli ATCC 8739 and saccharornyces pombe NCYC 1354. Benzisothiazolone can be used in the study of growth inhibition model [1].

• HY-100725

  BM212	Inhibitor	99.51%
  BM212 is a potent Mycobacterial membrane protein Large 3 (MmpL3) inhibitor. BM212 has strong bactericidal activity against both M. tuberculosis and some nontuberculosis mycobacteria. BM212 exhibits antimycobacterial activity against M. tuberculosis H37Rv with an MIC of 5 µM[1][2].

• HY-N2343R

  Procyanidin A2 (Standard)	Inhibitor
  Procyanidin A2 (Standard) is the analytical standard of Procyanidin A2. This product is intended for research and analytical applications. Procyanidin A2 is a flavonoid found in grapes, with anti-cancer, antioxidant, antimicrobial and anti-inflammation activity[1][2].

• HY-B0536

  Clinafloxacin	Inhibitor
  Clinafloxacin (AM 1091) is a potent and broad-spectrum fluoroquinolone antibiotic, has inhibitory activity against gram-positive, gram-negative bacterias, and anaerobic pathogens in vitro[1]. Clinafloxacin is against DNA gyrase and topoisomerase IV of?S. aureus with IC50 values of 0.92 μg/ml and 1.62 μg/ml, respectively[2].

• HY-P5656

  Brevinin-1Ea
  Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta[1].

• HY-N7112A

  Leucomycin tartrate
  Leucomycin tartrate (Kitasamycin tartrate) is a potent 16-membered macrolideantibiotic[1].

• HY-122143

  V-06-018	Inhibitor
  V-06-018 is a potent LasR antagonist with an IC50 value of 5.2 µM. V-06-018 can be used as chemical probes of quorum sensing (QS) in Pseudomonas aeruginosa[1].

• HY-135889

  CPFX2090	Inhibitor
  CPFX2090 is a cephalosporin antibacterial compound extracted from patent WO2013052568A1, Compound Example 16g[1].

• HY-155060

  Antibacterial agent 144	Inhibitor
  Antibacterial agent 144 (compound 8e) is an antibacterial agent，with better effect against multi-resistant Staphylococcus aureus than Chloromycin and Amoxicillin (HY-B0467A). Antibacterial agent 144 destroys the cytoplasmic membrane of bacteria，and inhibits the biofilms formation. Antibacterial agent 144 binds to HSA (Kd=13.2 μM)，and exerts bactericidal efficacy. Antibacterial agent 144 also binds with DNA to for supramolecular complex to obstruct DNA replications[1].

• HY-17574R

  Thio-TEPA (Standard)	Inhibitor
  Thio-TEPA (Standard) is the analytical standard of Thio-TEPA. This product is intended for research and analytical applications. Thio-TEPA is a DNA alkylating agent, with antitumor activity.

• HY-N0262

  Cordycepin	Inhibitor
  Cordycepin (3'-Deoxyadenosine) is a nucleoside derivative and inhibits IL-1β-induced MMP-1 and MMP-3 expression in rheumatoid arthritis synovial fibroblasts (RASFs) in a dose-dependent manner[1]. Cordycepin kills Mycobacterium tuberculosis through hijacking the bacterial adenosine kinase[2].

• HY-P5549

  Hb 98–114	Inhibitor
  Hb 98-114, the amino acids 98-114 of the alpha subunit of bovine hemoglobin, is an antimicrobial peptide. Hb 98-114 is active against several yeast and filamentous fungi (MIC: 2.1 μM-12.5 μM)[1].

• HY-123265

  Luteoreticulin
  Luteoreticulin is a nitro-containing bacterial metabolite originally isolated from S. luteoreticuli. It has mosquitocidal activity against A. aegypti when used at a concentration of 6.25 mg/L and nematocidal activity against C. elegans.

• HY-N6067

  Primin	Inhibitor
  Primin is a natural product stored in trichomes on leaves and stems of Primula obconica, with antimicrobial and antitumour properties[1][2].

• HY-N0110

  Palmatine chloride	Inhibitor	99.81%
  Palmatine chloride is an orally active and irreversible indoleamine 2,3-dioxygenase 1 (IDO-1) inhibitor with IC50s of 3 μM and 157μM against HEK 293-hIDO-1 and rhIDO-1, respectively. Palmatine chloride can also inhibit West Nile virus (WNV) NS2B-NS3 protease in an uncompetitive manner with an IC50 of 96 μM. Palmatine chloride shows anti-cancer, anti-oxidation, anti-inflammatory, neuroprotection, antibacterial, anti-viral activities[1][2][3][4][5].

• HY-A0256A

  Clavulanate potassium	Inhibitor
  Clavulanate potassium is a potent β-lactamase inhibitor and acts as an antibiotic[1][2].

• HY-N0565R

  Doxycycline (Standard)	Inhibitor
  Doxycycline (Standard) is the analytical standard of Doxycycline. This product is intended for research and analytical applications. Doxycycline, an antibiotic, is an orally active and broad-spectrum metalloproteinase (MMP) inhibitor[1]. Doxycycline shows antibacterial activity and anti-cancer cell proliferation activity[1][2][3][4][5].

• HY-B0732R

  Itopride (hydrochloride) (Standard)
  Itopride (hydrochloride) (Standard) is the analytical standard of Itopride (hydrochloride). This product is intended for research and analytical applications. Itopride (HSR803) hydrochloride is a potent dopamine-2 antagonist and an acetylcholine esterase (AChE) inhibitor. Itopride hydrochloride enhances gastric motility through both antidopaminergic and anti-acetylcholinesterasic actions, can be used as a gastrointestinal prokinetic agent. Itopride can be used for researching gastro-esophageal reflux disease (GERD)[1][2].

• HY-168063

  Antibiofilm agent-11
  Antibiofilm agent-11 (compound C12) is a xanthone derivative with anti-biofilm activity[1].

• HY-A0241R

  Dalfopristin (Standard)	Inhibitor
  Stearic acid (Standard) is the analytical standard of Stearic acid. This product is intended for research and analytical applications. Stearic acid is a long-chain dietary saturated fatty acid that can significantly reduce visceral fat by inducing apoptosis of preadipocytes. Stearic acid can be used in the study of cardiovascular and metabolic diseases[1].

• HY-16752

  Relebactam	Inhibitor	99.72%
  Relebactam is a diazabicyclooctane inhibitor with activity against a wide spectrum of β-lactamases, including class A (extended-spectrum β-lactamases and KPC) and class C (AmpC) enzymes. Relebactam shows antibacterial activity[1].

• HY-N2510

  Myristicin	Inhibitor	99.89%
  Myristicine is an orally bioavailable serotonin receptor antagonist and weak monoamine oxidase (MAO) inhibitor. Myristicine also exerts anti-cancer effects on gastric cancer cells by inhibiting the EGFR/ERK signaling pathway. Myristicine is the main component of nutmeg essential oil and has anti-cancer, anti-proliferative, antibacterial, anti-inflammatory and apoptosis-inducing effects. Myristicine abuse can produce hallucinogenic effects, organ damage, etc[1][2][3][4].

• HY-116034

  Arasertaconazole	Inhibitor
  Arasertaconazole is a potent 14α-lanosterol demethylase inhibitor. Arasertaconazole has antifungal and antibacterial activity[1].

• HY-B0221S

  Amphotericin B-13C6
  Amphotericin B-13C6 is 13C labeled Amphotericin B (HY-B0221). Amphotericin B is a polyene antifungal agent against a wide variety of fungal pathogens. It binds irreversibly to ergosterol, resulting in disruption of membrane integrity and ultimately cell death.

• HY-W799435

  Tosufloxacin hydrate	Inhibitor
  Tosufloxacin (A-61827) tosylate is an orally active fluoroquinolone antibiotic. Tosufloxacin tosylate shows a broad spectrum of antibacterial activity against gram-positive and gram-negative bacteria[1][2].

• HY-124712

  Divin	Inhibitor
  Divin, a potent chelator of iron, is a potent inhibitor of bacterial cell division with bacteriostatic effect in Gram-negative and Gram-positive bacteria. Divin disrupts the assembly of late division proteins, reduces peptidoglycan remodeling at the division site, and blocks compartmentalization of the cytoplasm[1][2][3].

• HY-N8300

  Rupesin E	Inhibitor
  Rupesin E is a natural product that can be isolated from Patrinia rupestris. Rupesin E has significant antibacterial activity against Escherichia coli[1].

• HY-Y1718R

  Tridecanoic acid (Standard)	Inhibitor
  Tridecanoic acid (Standard) is the analytical standard of Tridecanoic acid. This product is intended for research and analytical applications. Tridecanoic acid (N-Tridecanoic acid), a 13-carbon medium-chain saturated fatty acid, can serve as an antipersister and antibiofilm agent that may be applied to research bacterial infections. Tridecanoic acid inhibits Escherichia coli persistence and biofilm formation[1].

• HY-66005S4

  Acetaminophen-13C2,15N		98.30%
  Acetaminophen-13C2,15N is the 13C and 15N labeled Acetaminophen[1]. Acetaminophen (Paracetamol) is a selective cyclooxygenase-2 (COX-2) inhibitor with an IC50 of 25.8 μM;is a widely used antipyretic and analgesic agent[2][3][4]. Acetaminophen is a potent hepatic N-acetyltransferase 2 (NAT2) inhibitor[5].

• HY-107813

  Amikacin sulfate	Inhibitor	99.11%
  Amikacin sulfate (BAY 41-6551 sulfate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin sulfate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin sulfate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin sulfate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria[1][2].

• HY-146403

  Antibacterial agent 98	Inhibitor
  Antibacterial agent 98 (compound g37) is a potent and orally active antibacterial agent. Antibacterial agent 98 inhibits the ATPase activity of Gyrase B and impairs Staphylococcus aureus (S. aureus ) DNA supercoiling. Antibacterial agent 98 shows antibacterial activity and not induce resistance development of MRSA (methicillin-resistant S. aureus)[1].

• HY-118893

  Asukamycin	Inhibitor
  Asukamycin, a manumycin-type metabolite, could be isolated from Streptomyces nodosus subsp. asukaensis. Asukamycin is an antibiotic and has antimicrobial activity. Asukamycin inhibits growth of various tumor cell lines[1][2].

• HY-N0339R

  Syringic acid (Standard)	Inhibitor
  Syringic acid (Standard) is the analytical standard of Syringic acid. This product is intended for research and analytical applications. Syringic acid is correlated with high antioxidant activity and inhibition of LDL oxidation.

• HY-N2224

  Guaijaverin	Inhibitor	99.79%
  Guaijaverin is a urease inhibitor with an IC50 of 120 μM. Guaijaverin shows antioxidant and anti-Streptococcus mutans activities[1][2][3].

• HY-W105700

  Ethylenediaminetetraacetic acid sodium hydrate	Inhibitor
  Ethylenediaminetetraacetic acid (EDTA) sodium hydrate is a kind of metal chelating agent (binds to bivalent and trivalent metal cations, including calcium). Ethylenediaminetetraacetic acid sodium hydrate has antibacterial, anti-inflammatory, antioxidant, anti-hypercalcemia and anticoagulant activities. Ethylenediaminetetraacetic acid sodium hydrate decreases the metal ion-catalyzed oxidative damage to proteins, and allows maintenance of reducing environment during protein purification. Ethylenediaminetetraacetic acid sodium hydrate can alleviate the liver fibrosis. Ethylenediaminetetraacetic acid sodium hydrate can be used for coronary artery disease and neural system disease research[1][2][3][4][5][6][7].

• HY-125859B

  Lactoperoxidase, bovine milk	Inhibitor
  Lactoperoxidase, bovine milk is an antimicrobial protein that belongs to the mammalian heme peroxidase family. Lactoperoxidase, bovine milk uses H2O2 to catalyze the oxidation of its preferred halide substrates including I−, Br−, F−, or the pseudohalide SCN−[1].

• HY-N7057R

  Nonanoic acid (Standard)	Inhibitor
  Nonanoic acid (Standard) is the analytical standard of Nonanoic acid. This product is intended for research and analytical applications. Nonanoic acid is a naturally-occurring saturated fatty acid with nine carbon atoms. Nonanoic acid significantly reduces bacterial translocation, enhances antibacterial activity, and remarkably increases the secretion of porcine β-defensins 1 (pBD-1) and pBD-2[1].

• HY-18620

  DZ2002	Inhibitor	99.68%
  DZ2002 is an orally active, reversible and low-cytotoxic type III SAHH inhibitor (Ki=17.9 nM), with good immunosuppressive activity. DZ2002 prevents the development of experimental dermal fibrosis by reversing the profibrotic phenotype of various cell types. DZ2002 can be used in studies of autoimmune diseases such as lupus syndrome and systemic sclerosis[1][2].

• HY-163700

  Fabl inhibitor 1	Inhibitor
  Fabl inhibitor 1 (Compound (S)-n31) is an orally active and potent SaFabI inhibitor (IC50 = 94.0 nM, MIC = 0.25-1 μg/mL). Fabl inhibitor 1 can be used for the research of methicillin-resistant S. aureus (MRSA) infection[1].

• HY-146196

  Anticandidal agent-1	Inhibitor
  Anticandidal agent-1 (compound c2) is a potent and broad-spectrum anticandidal agent. Anticandidal agent-1 shows anticandidal activity against C. albicans and C. glabrata, with MIC50 values of 8.65 and 13.51 μg/mL, respectively. Anticandidal agent-1 inhibits biofilm by blocking hyphal elongation and filamentation[1].

• HY-A0147

  Grepafloxacin	Inhibitor
  Grepafloxacin (OPC-17116) is an oral actively fluoroquinolone antibiotic with potent activity against community-acquired respiratory pathogens including Streptococcus pneumonia. Grepafloxacin has high tissue penetration and a promising pharmacodynamic profile[1][2][3].

• HY-B1222A

  Sisomicin	Inhibitor	98.45%
  Sisomicin is a broad-spectrum aminoglycoside antibiotic produced by Micromonospora inyoensis. Sisomicin is highly active against Gram-positive bacteria[1][2].

• HY-118946B

  BPH-1358 mesylate	Inhibitor
  BPH-1358 mesylate (NSC50460 mesylate) is a potent human farnesyl diphosphate synthase (FPPS) and undecaprenyl diphosphate synthase (UPPS) inhibitor with IC50s of 1.8 μM and 110 nM, respectively. BPH-1358 mesylate is active against S. aureus in vitro (MIC ~250 ng/mL)[1][2].

• HY-B0421S

  Mycophenolic acid-d3
  Mycophenolic acid-d3 is deuterium labeled Mycophenolic acid, which is an an immunosuppresant agent and has potent anti-proliferative activity.

• HY-P1222B

  LL-37, human acetate	Inhibitor	99.71%
  LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing[1][2][3].

• HY-115883

  PptT-IN-2
  PptT-IN-2 (compound 5k) is a potent inhibitor of with phosphopantetheinyl phosphoryl transferase (PptT) an IC50 of 2.5 μM. Phosphopantetheinyl transferase, an essential enzyme that plays a critical role in the biosynthesis of cellular lipids and virulence factors in Mycobacterium tuberculosis. PptT-IN-2 has the potential for the research of tuberculosis[1].

• HY-Q50147

  Antimicrobial agent-21	Inhibitor
  Antimicrobial agent-21 (Compound IIm) is a bacterial inhibitor. Antimicrobial agent-21 is active against gram-positive and gram-negative bacterial[1].

• HY-D0008R

  Brilliant green (Standard)	Inhibitor
  Brilliant green (Standard) is the analytical standard of Brilliant green. This product is intended for research and analytical applications. Brilliant green is a cationic dye used to color silk and wool. Brilliant green inhibits propagation of mold, intestinal parasites and fungus. Brilliant green is effective against Gram-positive bacteria[1][2].

• HY-B1213A

  Trimipramine	Inhibitor
  Trimipramine is a 5-HT receptor antagonist, with pKi binding values of 6.39, 8.10, 4.66 for 5-HT1C, 5-HT2 and 5-HT1A, respectively. Trimipramine is also a potent and selective inhibitor targeting human noradrenaline (hNAT), serotonin (hSERT) and organic cation transporters (hOCT1, hOCT2) with IC50 values of 4.99 μM, 2.11 μM, 3.72 μM, 8.00 μM, respectively. Trimipramine has vascular activity and anxiolytic efficacy[1][2][3].

• HY-B0198R

  Cefaclor (Standard)	Inhibitor
  Cefaclor (Standard) is the analytical standard of Cefaclor. This product is intended for research and analytical applications. Cefaclor is a well-absorbed orally active cephalosporin antibiotic. Cefaclor can specifically bind to specific for penicillin-binding protein 3 (PBP3). Cefaclor can be used for the research kinds of infections caused by bacteria, such as respiratory tract infections, bacterial bronchitis, pharyngitis and skin infections[1][2][3].

• HY-126742

  MBX-1162
  MBX-1162 is a bisindole compound. In the study of its resistance mechanism in Staphylococcus aureus, it did not show cross-resistance with related compounds and was related to the substrate specificity of MepA and MepR.

• HY-B1190AR

  Cefadroxil (hydrate) (Standard)	Inhibitor
  Cefadroxil (hydrate) (Standard) is the analytical standard of Cefadroxil (hydrate). This product is intended for research and analytical applications. Cefadroxil hydrate (BL-S 578 hydrate) is an orally active and first-generation cephalosporin with a broad spectrum antibacterial activity. Cefadroxil hydrate (BL-S 578 hydrate) also acts as a substrate of the peptide transporter PEPT1 and PEPT2[1][2].

• HY-105099

  Rifalazil	Inhibitor
  Rifalazil (KRM-1648; ABI-1648), a rifamycin derivative, inhibits the bacterial DNA-dependent RNA polymerase and kills bacterial cells by blocking off the β-subunit in RNA polymerase[1]. Rifalazil (KRM-1648; ABI-1648) is an antibiotic, exhibits high potency against mycobacteria, gram-positive bacteria, Helicobacter pylori, C. pneumoniae and C. trachomatis with MIC values from 0.00025 to 0.0025 μg/ml[3]. Rifalazil (KRM-1648; ABI-1648) has the potential for the treatment of Chlamydia infection, Clostridium difficile associated diarrhea (CDAD), and tuberculosis (TB)[2].

• HY-139744

  FPI-1465	Inhibitor
  FPI-1465 acts a dual inhibitor of serine-β-Lactamases and Penicillin-binding proteins (PBPs).FPI-1465 inhibits PBP2 (IC50=1.0 µg/mL). FPI-1465 exhibits activity against β-lactamase CTX-M-15 and OXA-48 with Kds of 0.011 and 5.3 µM, respectively[1].

• HY-P1508

  Bactenecin	Inhibitor
  Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei[1][2][3].

• HY-13625

  Ertapenem sodium	Inhibitor	98.94%
  Ertapenem sodium (L-749345) is a broad spectrum and long acting β-lactam antibiotic. Ertapenem sodium has a broad-spectrum anti-anaerobic activity against a variety of anaerobes with a mode MIC of 0.12 μg/mL. Ertapenem sodium can be used for the research of severe infections caused by bacteria in the skin, lungs, stomach, pelvis, and urinary tract[1][2].

• HY-B0303AR

  Diphenhydramine (hydrochloride) (Standard)		99.90%
  Diphenhydramine (hydrochloride) (Standard) is the analytical standard of Diphenhydramine (hydrochloride). This product is intended for research and analytical applications. Diphenhydramine hydrochloride is a first-generation histamine H1-receptor antagonist with anti-cholinergic effect. Diphenhydramine hydrochloride can across the ovine blood-brain barrier (BBB)[1][2].

• HY-B0435R

  Roxithromycin (Standard)	Inhibitor
  Roxithromycin (Standard) is the analytical standard of Roxithromycin. This product is intended for research and analytical applications. Roxithromycin (RU-28965) is a semi-synthetic macrolide antibiotic.

• HY-B0572

  Zinc Pyrithione	Inhibitor	99.49%
  Zinc Pyrithione is an antifungal and antibacterial agent disrupting membrane transport by blocking the proton pump[1]. Zinc Pyrithione is also a copper ionophore that delivers copper into cells and is a useful tool for studying cuproptosis[2].

• HY-111747

  TBAJ-587	Inhibitor	98.01%
  TBAJ-587, a potent anti-tuberculosis agent, inhibits M.tb strain H37Rv growth with MIC90s of 0.006 and <0.02 μg/mL in MABA and LORA assay, respectively. TBAJ-587 inhibits hERG channel minimally, attenuates inhibition of the cardiac potassium channel protein coded by the hERG, which is important for cardiac repolarization[1].

• HY-113829

  Valnemulin	Inhibitor
  Valnemulin is an orally active broad-spectrum antibiotic against Gram-negative and Gram-positive bacteria, anaerobic bacteria, Mycoplasma, and Spirochetes. Valnemulin ameliorates enteric diseases, acute polyarthritis and enzootic pneumonia in pigs[1]. Valnemulin exhibits anti-inflammatory efficacy against lipopolysaccharide (HY-D1056)-induced lung injury[2].

• HY-B0441

  Tobramycin	Inhibitor	99.80%
  Tobramycin (Nebramycin Factor 6) is a parenterally administered, broad spectrum aminoglycoside antibiotic that is widely used in the treatment of moderate to severe bacterial infections due to sensitive organisms[1].Tobramycin can be used to pneumonia research caused by Pseudomonas aeruginosa[2][3].

• HY-N7139A

  Penicillin G benzathine	Inhibitor	99.85%
  Penicillin G benzathine (Benzathine benzylpenicillin) is an antibiotic against many bacterial infections[1].

• HY-101865

  KKL-10	Inhibitor
  KKL-10 is a small-molecule ribosome rescue inhibitor with broad-spectrum antimicrobial activity against bacteria.

• HY-W324882

  Salinazid		99.91%
  Salinazid is an antituberculous compound[1].

• HY-P5584

  Heliomicin
  Heliomicin is an antimicrobial peptide from Heliothis Virescens[1].

• HY-34516

  D-Ornithine hydrochloride
  D-Ornithine ((R)-Ornithine) hydrochloride is a constituent of bacterial cell wall. D-Ornithine hydrochloride promotes the production of L-arginine (HY-N0455). D-Ornithine hydrochloride enhances the expression of pyrrolysine-containing proteins[1][2][3].

• HY-B0389S

  D-Glucose-13C6,d7
  D-Glucose-13C6,d7 is the deuterium and 13C labeled D-Glucose[1].

• HY-B1175

  (2S,5R,6R)-Ticarcillin disodium	Inhibitor
  (2S,5R,6R)-Ticarcillin disodium is an injectable antibiotic for the treatment of Gram-negative bacteria, particularly Pseudomonas aeruginosa. It is also one of the few antibiotics capable of treating Stenotrophomonas maltophilia infections.

• HY-119246

  A-269A	Inhibitor
  A-269A is a streptothricin-like compound derived from Streptomyces sp. with antimicrobial activity[1].

• HY-105846

  Nogalamycin	Antagonist
  Nogalamycin is an anthracyclinone antibiotic. Nogalamycin is a potent antibiotic against Gram-positive bacteria, also has cytotoxicity against certain tumor cells. Nogalamycin is produced by Streptomyces nogalater var. Nogalater. Nogalamycin selectively inhibits RNA synthesis after binding to DNA template. Nogalamycin can be used for researching anticancer[1][2].

• HY-B0458

  Cefprozil monohydrate	Inhibitor	99.82%
  Cefprozil monohydrate (Cefzil) is a second-generation cephalosporin type antibiotic[1].

• HY-P10389

  Globomycin derivative G2A	Inhibitor
  Globomycin derivative G2A (Compound G2A) is an inhibitor for lipoprotein signal peptidase II (LspA), with an IC50 of 604 nM. Globomycin derivative G2A inhibits E. coli, P. aeruginosa and A. baumannii, with MIC ranging from 12.5 to 32 μg/mL[1].

• HY-122327

  Nodusmicin	Inhibitor
  Nodusmicin is a macrolide antibiotic against antibiotic-susceptible and -resistant S. aureus with MIC values of 125, 250 and 250 μg/mL for UC-76, UC-6685, and UC-6690 strains, respectively[1][2].

• HY-B0117

  Tigecycline	Inhibitor	99.95%
  Tigecycline (GAR-936) is a broad-spectrum glycylcycline antibiotic. The mean inhibitory concentration (MIC) of Tigecycline for E. coli (MG1655 strain) is approximately 125 ng/mL[1]. MIC50 and MIC90 are 1 and 2 mg/L for Acinetobacter baumannii (A. baumannii), respectively[2].

• HY-P2123A

  Colistin A sulfate hydrate	Inhibitor
  Colistin A sulfate hydrate is a major component of Colistin. Colistin is a polymyxin antibiotic and can be used to combat infections caused by problematic gram-negative bacteria[1].

• HY-152136

  Antituberculosis agent-6	Inhibitor
  Antituberculosis agent-6 (compound 9g) is a potent antimycobacterial agent. Antituberculosis agent-6 shows significant activity against M. tuberculosis, with a MIC of 3.49 μM. Antituberculosis agent-6 also shows good antifungal activity against A. niger, with a MIC of 62.50 μM. Antituberculosis agent-6 shows high GI absorption[1].

• HY-B0200BS

  Cephalexin-d5 monohydrate	Inhibitor
  Cephalexin-d5 (monohydrate) is the deuterium labeled Cephalexin monohydrate. Cephalexin monohydrate is a potent, orally active and the first-generation cephalosporin antibiotic. Cephalexin monohydrate kills gram-positive and some gram-negative bacteria by disrupting the growth of the bacterial cell wall. Cephalexin monohydrate is used for the research of pneumonia, strep throat, and bacterial endocarditis, et al[1].

• HY-N2472R

  Medicagenic acid (Standard)	Inhibitor
  Medicagenic acid (Standard) is the analytical standard of Medicagenic acid. This product is intended for research and analytical applications. Medicagenic acid (Castanogenin) is isolated from the roots of Herniaria glabra, exhibits potent fungistatic effects against several plant pathogens and human dermatophytes[1]. Medicagenic acid (Castanogenin) has low enzyme inhibitory activities, the target enzymes are xanthine oxidase, collagenase, elastase, tyrosinase, ChE[2].

• HY-N3386

  Licoricone	Inhibitor	99.60%
  Licoricone is an flavonoid extracted from licorice, exhibits anti-helicobacter pylori activity against the CLAR and AMOX-resistant strain as well as four CLAR (AMOX)-sensitive strains[1].

• HY-N9203

  Pinobanksin 5-methyl ether	Inhibitor
  Pinobanksin 5-methyl ether can be isolated from Georgian Propolises. Pinobanksin 5-methyl ether has anti-helicobacter activity. Pinobanksin 5-methyl ether is effective inducer of CYP9Q enzyme[1].

• HY-W015879

  2-Heptanol	Inhibitor
  2-Heptanol is one of the chemical compounds identified in turmeric and turmeric rhizome essential oil. 2-Heptanol can speed up amino acid metabolism and slow down membrane transport, exhibiting antibacterial activity. The rhizome essential oil has good antibacterial and antioxidant properties[1][2].

• HY-13777AR

  Zoledronic acid (monohydrate) (Standard)
  Zoledronic acid (monohydrate) (Standard) is the analytical standard of Zoledronic acid (monohydrate). This product is intended for research and analytical applications. Zoledronic acid monohydrate (Zoledronate monohydrate) is a third-generation bisphosphonate (BP), with potent anti-resorptive activity. Zoledronic acid monohydrate inhibits the differentiation and apoptosis of osteoclasts. Zoledronic acid monohydrate also has anti-cancer effects[1].

• HY-N12508

  Meliponamycin A	Inhibitor
  Meliponamycin A is an antimicrobial cyclodepsipeptide isolated from Streptomyces[1].

• HY-151160

  LasR-IN-1	Inhibitor
  LasR-IN-1 (compound 9g) is a potent LasR inhibitor. LasR-IN-1 has good efficacy toward E. coli. LasR-IN-1 shows anti-bacterial activity, with a MIC of 28.13 μM against P. aeruginosa[1].

• HY-B0097R

  Floxuridine (Standard)	Inhibitor
  Floxuridine (Standard) is the analytical standard of Floxuridine. This product is intended for research and analytical applications. Floxuridine (5-Fluorouracil 2'-deoxyriboside) is a pyrimidine analog and known as an oncology antimetabolite. Floxuridine inhibits Poly(ADP-Ribose) polymerase and induces DNA damage by activating the ATM and ATR checkpoint signaling pathways in vitro. Floxuridine is a extreamly potent inhibitor for S. aureus infection and induces cell apoptosis[1][2]. Floxuridine has antiviral effects against HSV and CMV[3].

• HY-162923

  Antibacterial agent 244	Inhibitor
  Antibacterial agent 244 is an orally active compound with broad-spectrum antibacterial activity, primarily targeting Gram-positive bacteria, with a MIC value of 1–4 μg/mL and low hemolytic toxicity (HC50 of 111.6 μg/mL). Antibacterial agent 244 disrupts bacterial transmembrane potential, increases membrane permeability, leading to leakage of cellular contents such as DNA and proteins, ultimately causing bacterial death. Antibacterial agent 244 can be used in research related to Gram-positive bacterial infections[1].

• HY-B0734

  Cefotiam	Inhibitor
  Cefotiam (SCE-963) is a parenteral cephalosporin antibiotic. Cefotiam has broad-spectrum activity against Gram-positive and Gram-negative bacteria[1][2].

• HY-137502

  ML267	Inhibitor
  ML267 a potent Sfp phosphopantetheinyl transferase (PPTases) inhibitor with an IC50 of 0.29 μM. ML267 also inhibits AcpS-PPTase with an IC50 of 8.1 μM. ML267 possesses specific Gram-positive-targeted bactericidal activities[1].

• HY-135398

  Decarboxy Moxifloxacin		98.89%
  Decarboxy Moxifloxacin (compound 8) is a decarboxylated compound of Moxifloxacin. Moxifloxacin is an orally active 8-methoxyquinolone antimicrobial for use in acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1].

• HY-124082R

  Dodecyl gallate (Standard)	Inhibitor
  Dodecyl gallate (Standard) is the analytical standard of Dodecyl gallate. This product is intended for research and analytical applications. Dodecyl gallate (Lauryl gallate) has been widely used as an antioxidant in food manufacturing, as well as in the pharmaceutical and cosmetic industries. Dodecyl gallate also is active against a highly relevant animal virus such as African swine fever virus (ASFV)[1].

• HY-139778

  Antibacterial agent 61	Inhibitor
  Antibacterial agent 61 (example 27) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-12479

  Epetraborole	Inhibitor
  Epetraborole (GSK2251052) is a leucyl-tRNA synthetase (LeuRS) inhibitor (IC50=0.31 μM), thereby inhibiting protein synthesis. Epetraborole can be used in multidrug-resistant gram-negative pathogens infection research[1][2][3].

• HY-135752

  Carbendazim mixture with flusilazole	Inhibitor
  Carbendazim mixture with flusilazole is a fungicide used to control sooty mold caused by Botrytis narcissicola. The disease is the most common foliar disease of daffodils (Narcissus cultivars) in the UK and causes significant losses in bulb and flower production. Carbendazim mixture with flusilazole was found to be effective in reducing lesion size and significantly reducing symptoms of secondary sooty mold after spraying when used in combination with several other fungicides. In field trials in Cambridgeshire and Lincolnshire, a spraying program using this fungicide mixture was effective in controlling sooty mold. In addition, alternating four to six sprays using two or three fungicides with different modes of action not only reduced disease damage but also increased bulb production. The study discusses the selection of appropriate fungicides and control methods that may reduce the number of spraying applications.

• HY-139987

  LeuRS-IN-1	Inhibitor
  LeuRS-IN-1 is a potent, orally active M. tuberculosis leucyl-tRNA synthetase (M.tb LeuRS) inhibitor. LeuRS-IN-1 has IC50 and Kd values of 0.06 μM, 0.075 μM for M.tb LeuRS, respectively[1]. LeuRS-IN-1 inhibits human cytoplasmic LeuRS (IC50=38.8 μM), and HepG2 protein synthesis (EC50=19.6 μM)[2].

• HY-124082

  Dodecyl gallate	Inhibitor	99.99%
  Dodecyl gallate (Lauryl gallate) has been widely used as an antioxidant in food manufacturing, as well as in the pharmaceutical and cosmetic industries. Dodecyl gallate also acts antibacterial activity specifically against Gram-positive bacteria. Dodecyl gallate also is active against a highly relevant animal virus such as African swine fever virus (ASFV)[1].

• HY-N0570R

  Hydroxytyrosol (Standard)	Inhibitor
  Hydroxytyrosol (Standard) is the analytical standard of Hydroxytyrosol. This product is intended for research and analytical applications. Hydroxytyrosol (DOPET) is a phenolic compound with anti-oxidant, anti-atherogenic, anti-thrombotic, antimicrobial, anti-inflammatory and anti-tumour effects[1][2].

• HY-B1743AR

  Puromycin (dihydrochloride) (Standard)	Inhibitor
  Puromycin (dihydrochloride) (Standard) is the analytical standard of Puromycin (dihydrochloride). This product is intended for research and analytical applications. Puromycin dihydrochloride (CL13900 dihydrochloride), an aminonucleoside antibiotic, inhibits protein synthesis[1].

• HY-W004296

  1-Heptadecanol	Inhibitor	99.88%
  1-Heptadecanol is a long-chain primary alcohol with antibacterial activity from Solena amplexicaulis leaves[1].

• HY-167685

  (E/Z)-Aureusidin	Inhibitor
  (E/Z)-Aureusidin is a flavonoid compound with antioxidant activity. (E/Z)-Aureusidin can inhibit the production of reactive oxygen species and reduce cell damage. (E/Z)-Aureusidin has anti-inflammatory effects and can reduce the expression of inflammatory factors. (E/Z)-Aureusidin has inhibitory effects on a variety of bacteria, indicating its potential antimicrobial properties[1].

• HY-108879

  Cefotetan disodium	Inhibitor
  Cefotetan disodium is a semisynthetic cephamycin antibiotic that exerts its bactericidal effects by inhibition of cell-wall synthesis[1].

• HY-N10087A

  Angustifoline hydrochloride	Inhibitor
  Angustifoline hydrochloride, an alkaloid, can be isolated from Lupinus angustifolius L. alkaloid extract. Angustifoline hydrochloride exhibits antimicrobial activity. Angustifoline hydrochloride could have bacteriostatic effects against S. aureus, B. subtilis, E. coli, P. aeruginosa and B. thuringiensis[1].

• HY-118675

  L-erythro-Chloramphenicol
  L-erythro-Chloramphenicol acts as a powerful inhibitor of electron transport.

• HY-N5113

  6α-Chloro-5β-hydroxywithaferin A
  6α-Chloro-5β-hydroxywithaferin A is a withanolide that can be isolated from W. somnifera. W. somnifera has antioxidant, anti-inflammatory, immunomodulatory, anticarcinogenic, antibacterial antiparkinsonism and antistress properties[1].

• HY-144728

  MraY-IN-3 hydrochloride	Inhibitor
  MraY-IN-1 (compound 12a) is a potent  MraY inhibitor with an IC50 value of 140 μM. MraY-IN-1 has antimicrobial activity against Escherichia coli K12, Bacillus subtilis W23 and Pseudomonas fluorescens Pf-5 with MIC50s of 7 µg/mL, 12 µg/mL and 46 µg/mL, respectively. MraY-IN-1 can be used for researching anti-bacteria[1].

• HY-B1210R

  Pipemidic acid (Standard)	Inhibitor
  Pipemidic acid (Standard) is the analytical standard of Pipemidic acid. This product is intended for research and analytical applications. Pipemidic acid , a derivative of Piromidic acid, is an antibacterial agent. Pipemidic acid inhibits DNA gyrase. Pipemidic acid is active against gram-negative bacteria including Pseudomonas aeruginosa as well as some gram-positive bacteria. Pipemidic acid can be used for the research of intestinal, urinary, and biliary tract infections[1][2].

• HY-P5613

  XT-1	Inhibitor
  XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-1 has strong activity against S.aureus, E.coli and C.albicans, the vaule of MIC are 5, 6, 50 μM , respectively[1].

• HY-17514S1

  Itraconazole-d3		99.62%
  Itraconazole-d3 is the deuterium labeled Itraconazole (HY-17514)[1].

• HY-B0213S

  Sulfameter-d4	Inhibitor
  Sulfameter-d4 (Sulfametoxydiazine-d4; 5-Methoxysulfadiazine-d4) is the deuterium labeled Sulfameter (HY-B0213)[1]. Sulfameter (Sulfametoxydiazine; 5-Methoxysulfadiazine) is an effective long-acting sulfonamide antibiotic with antibacterial activities. Sulfameter can be used for the research of urinary tract infections and lepriasis[2].

• HY-155250

  Antibacterial agent 154	Inhibitor
  Antibacterial agent 154 (compound 7) is a derivative of Fluoroqinolones and is an orally effective antibacterial agent. Antibacterial agent 154 inhibits Gram-positive and Gram-negative bacteria. Antibacterial agent 154 demonstrated in vivo efficacy in a mouse model of staphylococcal sepsis[1].

• HY-113601

  Linatine	Inhibitor
  Linatine is an antagonist for Vitamin B6 (HY-150525). Linatine inhibits the growth of chicken and Azotobacter vinelandii, induces vitamin B6 deficiency symptoms in chickens[1].

• HY-P2145

  Extracellular death factor	Inhibitor
  Extracellular death factor (EDF) is the only single signaling molecule involved in Escherichia coli quorum sensing, and can initiate MAZEF-mediated cell death. Extracellular death factor significantly amplifies the endoribonucleolytic activities of both MazF and ChpBK[1].

• HY-146489

  Anti-infective agent 3	Inhibitor
  Anti-infective agent 3 (compound 3l) shows antiparasitic activity against P. falciparum and T. brucei rhodesiense, with IC50 values of 0.47 and 0.13 μM, respectively. Anti-infective agent 3 shows antimycobacterial activity against Mycobacterium smegmatis with a MIC of 4 μg/mL[1].

• HY-14519

  Methotrexate
  Methotrexate (Amethopterin), an antimetabolite and antifolate agent, inhibits the enzyme dihydrofolate reductase, thereby preventing the conversion of folic acid into tetrahydrofolate, and inhibiting DNA synthesis. Methotrexate, also an immunosuppressant and antineoplastic agent, is used for the research of rheumatoid arthritis and a number of different cancers (such as acute lymphoblastic leukemia)[1][2][3].

• HY-B0573

  Propranolol hydrochloride
  Propranolol hydrochloride is a nonselective β-adrenergic receptor (βAR) antagonist, has high affinity for the β1AR and β2AR with Ki values of 1.8 nM and 0.8 nM, respectively[1]. Propranolol hydrochloride inhibits [3H]-DHA binding to rat brain membrane preparation with an IC50 of 12 nM[2]. Propranolol hydrochloride is used for study of hypertension, pheochromocytoma, myocardial infarction, cardiac arrhythmias, angina pectoris, and hypertrophic cardiomyopathy[3].

• HY-B1290S

  2-Phenylethanol-d4
  2-Phenylethanol-d4 is the deuterium labeled 2-Phenylethanol[1]. 2-Phenylethanol (Phenethyl alcohol), extracted from rose, carnation, hyacinth, Aleppo pine, orange blossom and other organisms, is a colourless liquid. It has a pleasant floral odor and also an autoantibiotic produced by the fungus Candida albicans[2]. It is used as an additive in cigarettes and also used as a preservative in soaps due to its stability in basic conditions.

• HY-105041

  Tedizolid phosphate sodium
  Tedizolid phosphate (TR-701FA) sodium is a MAO-A and MAO-B inhibitor with activity against Gram-positive bacteria[1].

• HY-162839

  Cerastecin D	Inhibitor
  Cerastecin D (compound 1) is an antibacterial agent. Cerastecin D shows inhibition on Acinetobacter baumannii ATCC19606 with MITC95 values of 165 nM[1].

• HY-B0272S2

  Rifampicin-d4	Inhibitor	99.69%
  Rifampicin-d4 is the deuterium labeled Rifampicin. Rifampicin is a potent and broad spectrum antibiotic against bacterial pathogens. Rifampicin has anti-influenza virus activities.

• HY-124456

  Unguinol	Inhibitor
  Unguinol is a depsidone originally isolated from A. unguis. It is an inhibitor of pyruvate phosphate dikinase (PPDK; IC50=42.3 μM). It inhibits the growth of plants utilizing C4, but not C3, carbon fixation. Unguinol also inhibits the growth of the bacteria S. aureus and V. harveyi (GI50s=8.7 and 69.5 μM, respectively) and H460, MCF-7, and SF-268 cancer cells (GI50s=28.2, 50.8, and 44.3 μM, respectively).

• HY-114716

  Jacareubin	Inhibitor
  Jacareubin is a xanthone compound that can be isolated from Calophyllum brasiliense. Jacareubin has antibacterial, antioxidant, gastroprotective properties, and also has certain cancer cell toxicity, which can be used in cancer research[1].

• HY-B0535S

  Ethambutol-d4	Inhibitor	98.12%
  Ethambutol-d4 is the deuterium labeled Ethambutol. Ethambutol is a bacteriostatic antimycobacterial agent, which obstructs the formation of cell wall by inhibiting arabinosyl transferases.

• HY-N0004R

  Oridonin (Standard)	Inhibitor
  Oridonin (Standard) is the analytical standard of Oridonin. This product is intended for research and analytical applications. Oridonin (NSC-250682), a diterpenoid isolated from Rabdosia rubescens, acts as an inhibitor of AKT, with IC50s of 8.4 and 8.9 μM for AKT1 and AKT2; Oridonin possesses anti-tumor, anti-bacterial and anti-inflammatory effects.

• HY-W747311

  Ritipenem	Inhibitor
  Ritipenem is a penicillin antibiotic, that targets penicillin-binding protein with good affinity (IC50 in levels of ng/mL), and exhibits antibacterial properties. Ritipenem exhibits antiviral activity against Haemophilus influenzae[1].

• HY-P9908

  Adalimumab
  Adalimumab is a human monoclonal IgG1 antibody targeting tumour necrosis factor α (TNF-α).

• HY-N13885

  Amythiamicin A	Inhibitor
  Amythiamicin A is an antimicrobial antibiotic against Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus (MRSA)) and activity against Plasmodium falciparum[1].

• HY-B0212S

  Sulfapyridine-d4	Inhibitor
  Sulfapyridine-d4 a deuterium labeled Sulfapyridine. Sulfapyridine is a sulfonamide antibacterial[1].

• HY-124509

  Pyrocoll
  Pyrocoll is a bacterial metabolite originally isolated from Streptomyces. It inhibits the growth of A. aurescens, A. globiformis, A. oxydans, A. pascens, and R. erythropolis bacteria (MICs=10, 1, 10, 3, and 10 μg/mL, respectively) and HMO2, HepG2, and MCF-7 cancer cells (GI50s=0.28, 0.42, and 2.2 μg/mL, respectively) in vitro. Pyrocoll is also active against P. falciparum and T. rhodesiense (IC50s=1.19 and 1.97 μg/mL, respectively).

• HY-W108875

  Mupirocin lithium	Inhibitor
  Mupirocin (BRL-4910A) lithium is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin lithium apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis[1][2][3][4][5].

• HY-W008226

  Phloracetophenone	Inhibitor
  Phloracetophenone (2,4,6-trihydroxyacetophenone) is the aglycone part of acetophenone glycoside obtained from Curcuma comosa Roxb, with cholesterol-lowering activity. Phloracetophenone enhances cholesterol 7α-hydroxylase (CYP7A1) activity[1]. Phloracetophenone stimulats bile secretion mediated through Mrp2[2].

• HY-156439

  Antibiofilm agent-2	Inhibitor
  Antibiofilm agent-2 (compound 4T) is a potent biofilm inhibitor with an IC50 of 3.6 μM. Antibiofilm agent-2 inhibits the quorum sensing system and iron homeostasis as antibacterial synergists against Pseudomonas aeruginosa[1].

• HY-151497

  Antimicrobial agent-10	Inhibitor
  Antimicrobial agent-10 is a SARS-CoV-2 inhibitor with outstanding antibacterial activity[1].

• HY-W009762S1

  L-Lysine6-13C dihydrochloride	Inhibitor
  L-Lysine6-13C (dihydrochloride) is a 13C-labeled L-Lysine dihydrochloride.

• HY-N12262

  (+)-Epieudesmin	Inhibitor
  (+)-Epieudesmin is an antineoplastic agent. (+)-Epieudesmin has marginal cancer cell line inhibitory activities. (+)-Epieudesmin inhibits the growth of Gram-negative pathogen[1].

• HY-B0510A

  Trimethoprim sulfate	Inhibitor
  Trimethoprim sulfate is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim sulfate is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim sulfate has the potential for the research of urinary tract infections, Shigellosis and Pneumocystis pneumonia. Trimethoprim sulfate can inhibit infection of Influenza A virus in chick embryo when combinated with zinc[1][2][3][4].

• HY-14956S

  Nemonoxacin-d3	Inhibitor	99.77%
  Nemonoxacin-d3 is the deuterium labeled Nemonoxacin. Nemonoxacin (TG-873870) is an orally active and potent broad-spectrum antibiotic. Nemonoxacin shows good inhibitory activity against different species of staphylococci, streptococci, and enterococci, Neisseria gonorrhoeae, and Haemophilus influenza. Nemonoxacin can be used in the study of bacterial infections and community-acquired pneumonia[1][2][3].

• HY-P4200

  Lugdunin	Inhibitor
  Lugdunin is an antibiotic peptide. Lugdunin inhibits bacteria by dissipating their membrane potential. Lugdunin is active against Gram-positive bacteria, such as S. aureus, and reduces S. aureus skin and nasal colonization. Lugdunin induces LL-37 and CXCL8/MIP-2 in human keratinocytes and mouse skin[1].

• HY-66011BS

  (Rac)-Moxifloxacin-d4	Inhibitor
  (Rac)-Moxifloxacin-d4 ((Rac)-BAY 12-8039-d4 (free base)) is deuterium labeled (Rac)-Moxifloxacin. (Rac)-Moxifloxacin ((Rac)-BAY 12-8039 free base) is the isoform of Moxifloxacin Hydrochloride (HY-66011), which is an oral 8-methoxyquinolone antimicrobial for use in the treatment of acute bacterial sinusitis, acute bacterial exacerbations of chronic bronchitis, and community-acquired pneumonia[1][2].

• HY-P5561

  Aurein 2.2	Inhibitor
  Aurein 2.2 is a major component of the skin secretion of L.aurea. Aurein 2.2 is an antibiotic with broad-spectrum antibacterial activity against Gram positive bacteria such as Staphylococcus aureus and S. epidermidis[1][2].

• HY-D0008

  Brilliant green	Inhibitor
  Brilliant green is a cationic dye used to color silk and wool. Brilliant green inhibits propagation of mold, intestinal parasites and fungus. Brilliant green is effective against Gram-positive bacteria[1][2].

• HY-B1568

  Bromodiphenhydramine	Inhibitor
  Bromodiphenhydramine (Ambodryl) is a potent antihistamine with antimicrobial property. Bromodiphenhydramine inhibits a large number of Gram negative and Gram positive bacteria. Bromodiphenhydramine can be used for cutaneous allergies research[1][2][3].

• HY-129306

  Gilvocarcin M	Inhibitor
  Gilvocarcin M is an antibiotic and can be isolated from S. gilvotanareus. Gilvocarcin M is active against S. aureus at a concentration of 32 µg/ml and inhibits growth of KB cells with the IC50 of 0.52 µg/ml. Gilvocarcin M intercalates into bacteriophage PM2 DNA[1][2][3][4].

• HY-N13952

  Arylomycin A1	Inhibitor
  Arylomycin A1 is a lipohexapeptide antibiotic against Gram-positive bacteria[1].

• HY-119657

  Cellocidin	Inhibitor
  Cellocidin is an agricultural antibiotic with preventive effects against rice bacterial leaf blight and is thought to work by inhibiting the α-ketoglutarate-succinate system in Xanthomonas sp.

• HY-15025

  Sildenafil		99.90%
  Sildenafil (UK-92480) is a potent phosphodiesterase type 5 (PDE5) inhibitor with an IC50 of 5.22 nM.

• HY-168932

  Antiangiogenic agent 8	Inhibitor
  Antiangiogenic agent 8 (Compound 3m) is an antibacterial agent with anti-angiogenic activity. The MIC values of Antiangiogenic agent 8 against E. coli, P. aeruginosa, B. subtilis, S. aureus, and C. glabrata are 16, 8, 4, 16, and 8 μg/mL, respectively, with MBC ranging from 32 to 64 μg/mL. Antiangiogenic agent 8 holds promise for applications in anti-infective therapy and cardiovascular disease research[1].

• HY-A0090

  Nitrofurantoin	Inhibitor	99.95%
  Nitrofurantoin is a potent and orally active broad-spectrum beta-lactamase antimicrobial agent. Nitrofurantoin acts as an antibiotic and can be used for the study of urinary tract infections (UTIs), including cystitis and kidney infections[1].

• HY-N7067

  Revaprazan hydrochloride	Inhibitor	99.98%
  Revaprazan hydrochloride is a novel acid pump antagonist (APA). Revaprazan hydrochloride reduces COX-2 expression and has significant anti-inflammatory actions activities in H. pylori infection[1].

• HY-B1286

  Piperacillin sodium	Inhibitor	98.22%
  Piperacillin sodium is a semisynthetic broad-spectrum β-lactam antibiotic which exhibits potent bactericidal activity against Gram-negative bacteria as well as select Gram-positive strains through penicillin-binding proteins. Piperacillin is most commonly used in combination with the β-lactamase inhibitor Tazobactam[1][2][3].

• HY-B0276S

  Ethionamide-d3	Inhibitor
  Ethionamide-d3 is the deuterium labeled Ethionamide. Ethionamide (2-ethylthioisonicotinamide) is an antibiotic used in the treatment of tuberculosis.

• HY-Y0272R

  Saccharin (Standard)	Inhibitor
  Saccharin (Standard) is the analytical standard of Saccharin. This product is intended for research and analytical applications. Saccharin is an orally active, non-caloric artificial sweeteners (NAS). Saccharin has bacteriostatic and microbiome-modulating properties[1].

• HY-121657R

  Ornidazole diol (Standard)	Inhibitor
  Ornidazole diol (Standard) is an analytical standard for Ornidazole diol. This product is used for research and analytical applications. Ornidazole diol (Ro 11-2616) is the diol of Ornidazole (HY-B0508) which is rapidly hydrolyzed in alkaline solution. Ornidazole (Ro 7-0207) is a 5-nitroimidazole derivative that is antiprotozoan and anaerobic.

• HY-W191692

  Phentolamine acetate	Inhibitor
  Phentolamine acetate is a compound with anti-inflammatory and anticancer activities. Phentolamine acetate has been shown to inhibit the growth of certain bacteria, including Staphylococcus aureus. Phentolamine acetate exhibits potent biological activity in vitro[1].

• HY-N12669

  Curcumin monoglucoside	Inhibitor
  Curcumin monoglucoside is a flavonoid derivative possessing antioxidant, anti-apoptotic, neuroprotective effects, and antibacterial activity. Curcumin monoglucoside can be used in research on Parkinson's disease.[1][2]

• HY-B0356AR

  Ciprofloxacin (monohydrochloride) (Standard)	Inhibitor
  Ciprofloxacin (monohydrochloride) (Standard) is the analytical standard of Ciprofloxacin (monohydrochloride). This product is intended for research and analytical applications. Ciprofloxacin (Bay-09867) monohydrochloride is a potent, orally active topoisomerase IV inhibitor. Ciprofloxacin monohydrochloride induces mitochondrial DNA and nuclear DNA damage and lead to mitochondrial dysfunction, ROS production. Ciprofloxacin monohydrochloride has anti-proliferative activity and induces apoptosis. Ciprofloxacin monohydrochloride is a fluoroquinolone antibiotic, exhibiting potent antibacterial activity[1][2][3][4].

• HY-B0132A

  Norfloxacin hydrochloride	Inhibitor
  Norfloxacin hydrochloride (MK-0366 hydrochloride) is a broad-spectrum antibiotic that is active against both Gram-positive and Gram-negative bacteria, which functions by inhibiting DNA gyrase.

• HY-W017212

  Methyl cinnamate	Inhibitor	99.47%
  Methyl cinnamate (Methyl 3-phenylpropenoate), an active component of Zanthoxylum armatum, is a widely used natural flavor compound. Methyl cinnamate (Methyl 3-phenylpropenoate) possesses antimicrobial activity and is a tyrosinase inhibitor that can prevent food browning. Methyl cinnamate (Methyl 3-phenylpropenoate) has antiadipogenic activity through mechanisms mediated, in part, by the CaMKK2-AMPK signaling pathway[1].

• HY-105838

  Sulfamethomidine
  Sulfamethomidine is an antibacterial agent[1].

• HY-W099729

  Ethylhexylglycerin	Inhibitor
  Ethylhexylglycerin has antimicrobial activity, inhibiting the growth of Acinetobacter spp., Pseudomonas aeruginosa complex, and Stenotrophomonas maltophilia. Ethylhexylglycerin can cause pigmentary contact dermatitis[1][2].

• HY-163630

  Antibacterial agent 217	Inhibitor
  Antibacterial agent 217 (Compound 24) is a non-cytotoxic, non-hemolytic, moderately active antibacterial agent that inhibits the growth of Staphylococcus aureus strains with a minimum inhibitory concentration (MIC) of 32 μg/mL. Antibacterial agent 217 also moderately inhibits the growth of Staphylococcus epidermidis[1].

• HY-14879R

  Avibactam (free acid) (Standard)	Inhibitor

• HY-N14041

  Arizonin A2	Inhibitor
  Arizonin A2 is a microbial metabolite with anti-Gram-positive bacterial activities[1].

• HY-17425B

  Valacyclovir hydrochloride hydrate
  Valacyclovir hydrochloride hydrate is a potent antiviral agent. Valacyclovir hydrochloride hydrate can be used in the management of herpes simplex, herpes zoster and herpes B. Valacyclovir hydrochloride hydrate can be formulate ocular inserts for the research of ocular herpes. Valacyclovir hydrochloride hydrate is a precursor and can be rapidly converted into acyclovir in vivo[1][2].

• HY-B0210

  Cefoperazone	Inhibitor	99.90%
  Cefoperazone, a semisynthetic cephalosporin, has a broad spectrum of antibacterial activity[1].

• HY-N12180A

  Hodgkinsine	Inhibitor
  Hodgkinsine is an opioid receptor agonist and NMDA receptor antagonist, which has analgesic and anti-injurial effects. In addition, Hodgkinsine has antiviral, antibacterial and antifungal activities[1][2].

• HY-122494

  Bilanafos	Inhibitor
  Bilanafos is a natural organic phosphine tripeptide antibiotic metabolized by Streptomyces hydroscopius or Streptomyces viridochromeogenes. Bialaphos has antimicrobial activity aganist Gram-negative and positive bacteria as well as some fungal plant diseases[1].

• HY-14737A

  Ceftaroline fosamil hydrate	Inhibitor
  Ceftaroline fosamil hydrate is a potent cephalosporin antibiotic. Ceftaroline fosamil hydrateshows broad-spectrum activity against Gram-positive pathogens, including methicillin-resistant Staphylococcus aureus (MRSA) and multidrug-resistant Streptococcus pneumoniae, and common Gram-negative organisms. Ceftaroline fosamil hydrate has anti-infective activity, and can be used for the research of complicated skin and skin structure infections (cSSSIs) and community-acquired bacterial pneumonia (CABP)[1][2][3].

• HY-121272AS

  Difloxacin-d3 hydrochloride trihydrate	Inhibitor
  Difloxacin-d3 (hydrochloride trihydrate) is a deuterium labeled Difloxacin. Difloxacin is an antimicrobial agent[1].

• HY-N7985

  Pendulone	Inhibitor
  Pendulone is a isoflavanquinone with good antiplasmodial activity with an IC50 of 7.0 µM. Pendulone also has antileishmanial, antibacterial and anticancer activity[1][2].

• HY-W009304

  Methylarbutin	Inhibitor
  Methylarbutin exhibits anti-inflammatory and urinary antiseptic activity[1].

• HY-162376

  T3SS-IN-4	Inhibitor
  T3SS-IN-4 (Compound Z-8) is a T3SS inhibitor that can inhibit the expression of Xanthomonas oryzae pv oryzae (Xoo) T3SS-related genes without affecting bacterial growth. T3SS-IN-4 can effectively reduce the hypersensitive response (HR) induced by Xoo in tobacco and lower the pathogenicity of Xoo in rice[1].

• HY-B0318S2

  Metronidazole-d3	Inhibitor
  Metronidazole-d3 is deuterium labeled Metronidazole.

• HY-125414

  Lydicamycin
  Lydicamycin is an antibiotic isolated from the fermentation broth of an actinomycete strain identified as Streptomyces lydicus. Lydicamycin is active against Gram-positive bacteria and a certain yeast, but inactive against Gram-negative bacteria[1].

• HY-130046R

  16-Epiestriol (Standard)	Inhibitor
  16-Epiestriol (Standard) is the analytical standard of 16-Epiestriol. This product is intended for research and analytical applications. 16-Epiestriol is a metabolite of the endogenous estrogen estrone with antibacterial and anti-inflammatory effects[1][2][3].

• HY-Y1250S6

  Fmoc-Gly-OH-13C2,15N	Inhibitor
  Fmoc-Gly-OH-13C2,15N is a 15N-labeled and 13C-labled Crystal Violet. Crystal violet (Basic Violet 3) is a triarylmethane dye. Crystal Violet (Gentian Violet) has antiviral effects against H1N1 and also has prominent bactericidal activities.

• HY-124819

  D13-9001	Inhibitor
  D13-9001 is a potent AcrB (AcrAB-TolC efflux pump subunit) and MexB (MexAB-OprM efflux pump subunit) inhibitor with the KD values of 1.15 μM and 3.57 μM in E. coli and P. aeruginosa, respectively[1]. D13-9001 exhibits antibiotic activities[2].

• HY-P5647

  PhD1	Inhibitor
  PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans[1].

• HY-N7114AR

  Chloramphenicol succinate (sodium) (Standard)	Inhibitor
  Chloramphenicol succinate (sodium) (Standard) is the analytical standard of Chloramphenicol succinate (sodium). This product is intended for research and analytical applications. Chloramphenicol succinate sodium is a proagent of Chloramphenicol, with Haemotoxicity. Chloramphenicol succinate is a competitive substrate and inhibitor of succinate dehydrogenase (SDH) that is the possible reason for its toxicity[1][2][3].

• HY-B0454S2

  Miconazole-d2
  Miconazole-d2 is the deuterium labeled Miconazole[1]. Miconazole (R18134) is an imidazole antifungal agent. Miconazole also has antibacterial effects[2][3].

• HY-115367

  Aldgamycin G	Inhibitor
  Aldgamycin G is a macrolide antibiotic active against Gram-positive bacteria and can be isolated from Streptomyces avidinii[1].

• HY-N12276

  (±)-Emodin bianthrone	Inhibitor
  (±)-Emodin bianthrone (compound 10), a natural product, exhibits antimalarial, antitubercular and ntifungal activities[1].

• HY-B0467AS

  Amoxicillin-13C6	Inhibitor
  Amoxicillin-13C6 is the 13C6 labeled Amoxicillin. Amoxicillin is an antibiotic with good oral absorption and broad spectrum antimicrobial activity.

• HY-B0947R

  Sulfanitran (Standard)	Inhibitor
  Sulfanitran (Standard) is the analytical standard of Sulfanitran. This product is intended for research and analytical applications. Sulfanitran is an antibacterial and anticoccidial agent used in poultry feeds. Sulfanitran also is a multidrug resistance protein 2 (MRP2) stimulator that can increase the affinity of MRP2 for estradiol-17-β-D-glucuronide (E217βG)[1][2].

• HY-B0905

  Tilmicosin	Inhibitor
  Tilmicosin (LY-177370) is an orally active calcium channel antagonist and macrolide antibiotic with antimicrobial activity. Tilmicosin mainly acts on the 50S subunit of bacterial ribosomes, inhibiting protein synthesis. Tilmicosin is effective in the treatment of respiratory diseases in livestock such as cattle, sheep and pigs. In addition, Tilmicosin has immunomodulatory and anti-inflammatory effects[1][2][3][4][5][6].

• HY-N7104

  Lactitol
  Lactitol (D-Lactitol), a nonabsorbable disaccharide, has the potential for constipation research[1].

• HY-14743

  Golotimod	Inhibitor	98.04%
  Golotimod (SCV-07), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod (SCV-07) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod (SCV-07) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2)[1][2][3].

• HY-B0898

  Ceftiofur sodium	Inhibitor	98.03%
  Ceftiofur sodium (sodium ceftiofur) is a semisynthetic antibiotic with antimicrobial activity against a wide range of Gram-positive and Gram-negative bacteria, aerobic and anaerobic, targeting livestock[1][2][3][4].

• HY-125163

  MM 47755	Inhibitor
  MM 47755 (8-O-Methyltetrangomycin; 6-Deoxy-8-O-methylrabelomycin) is an antibiotic with antibacterial activity. MM 47755 can be isolated from Streptomyces[1].

• HY-135181

  Daunosamnyl-daunorubicin	Inhibitor
  Daunosamnyl-daunorubic, an antibiotic, can bind calf thymus DNA[1].

• HY-101866

  KKL-35	Inhibitor	99.47%
  KKL-35 is a trans-translation tagging reaction inhibitor with an IC50 of 0.9 µM.

• HY-B1460

  Sulconazole mononitrate	Inhibitor
  Sulconazole mononitrate ((±)-Sulconazole mononitrate), an imidazole derivative, is a broad-spectrum fungicide. Sulconazole mononitrate can be used for the research of dermatomycoses, pityriasis versicolor, and cutaneous candidiasis[1][2].

• HY-N14306

  Aspersitin	Inhibitor
  Aspersitin is a metabolite of Aspergillus parasiticus with antibacterial activity[1].

• HY-161263

  Antibacterial agent 182	Inhibitor
  Antibacterial agent 182 (compound 8c) is an antibacterial agent that shows antibacterial activity against various Gram-positive bacteria, particularly against Vancomycin-resistant Enterococcus faecalis (MIC ≤0.125 μg/mL). Antibacterial agent 182 inhibits biofilm formation of Staphylococcus aureus and Pseudomonas aeruginosa at sub-MIC doses[1].

• HY-13234S

  Rifaximin-d6	Inhibitor
  Rifaximin-d6 is the deuterium labeled Rifaximin. Rifaximin is an orally administered, semi-synthetic, nonsystemic antibiotic derived from rifamycin SV with antibacterial activity[1][2].

• HY-15449R

  Kaempferide (Standard)	Inhibitor
  Kaempferide (Standard) is the analytical standard of Kaempferide. This product is intended for research and analytical applications.

• HY-B0303A

  Diphenhydramine hydrochloride
  Diphenhydramine hydrochloride is a first-generation histamine H1-receptor antagonist with anti-cholinergic effect. Diphenhydramine hydrochloride can across the ovine blood-brain barrier (BBB)[1][2].

• HY-B0458R

  Cefprozil (monohydrate) (Standard)	Inhibitor
  Cefprozil (monohydrate) (Standard) is the analytical standard of Cefprozil (monohydrate). This product is intended for research and analytical applications. Cefprozil monohydrate (Cefzil) is a second-generation cephalosporin type antibiotic[1].

• HY-170650

  SMase-IN-1
  SMase-IN-1 (Compound 4) is a bacterial sphingomyelinase enzyme (SMase) inhibitor (IC50 value for B. cereus SMase is 6.43 µM). SMase-IN-1 also inhibits eqBuChE (59.50% inhibition rate at 50 µM concentration). SMase-IN-1 forms a complex with Cu2+ in biometal interactions. SMase-IN-1 reduces B. cereus-induced hemolysis on sheep erythrocytes[1].

• HY-100007

  Vonoprazan	Inhibitor	99.40%
  Vonoprazan (TAK-438 free base), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan inhibits H+,K+-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease. Vonoprazan can be used for eradication of Helicobacter pylori[1][2][3].

• HY-14926

  Levonadifloxacin	Inhibitor	99.79%
  Levonadifloxacin ((S)-(-)-Nadifloxacin; WCK 771) is a broad-spectrum anti-staphylococcal agent. Levonadifloxacin shows antibacterial activity against Methicillin (HY-121544)-susceptible Staphylococcus aureus (MSSA) and Methicillin-resistant S. aureus (MRSA) strains, with a reduction of which phagocytized in THP-1 monocytes[1].

• HY-125965

  BioA-IN-13	Inhibitor
  BioA-IN-13 is a potent, cell permeable and whole-cell active inhibitor of Mycobacterium tuberculosis BioA enzyme[1].

• HY-17395AR

  Terbinafine (Standard)	Inhibitor
  Terbinafine (Standard) is the analytical standard of Terbinafine. This product is intended for research and analytical applications. Terbinafine (TDT 067) is an orally active and potent antifungal agent. Terbinafine is a potent non-competitive inhibitor of squalene epoxidase from Candida, with a Ki of 30 nM. Terbinafine also shows antibacterial activity against certain Gram-positive and Gram-negative bacteria[1][2][3]. Terbinafine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-138652

  L-Histidine benzyl ester bistosylate		99.86%
  L-Histidine benzyl ester bistosylate could play a role in the activation of HutP (an RNA-binding protein)[1].

• HY-14987

  AX20017	Inhibitor	99.69%
  AX20017 is a small-molecule protein kinase G (PknG) inhibitor with an IC50 of 0.39 μM.

• HY-168861

  NDM-1 inhibitor-8	Inhibitor
  NDM-1 inhibitor-8 (Compound 18b) is the covalent inhibitor for new delhi metallo-β-lactamase-1 (NDM-1) with an IC50 of 7.03 μM. NDM-1 inhibitor-8 inhibits the drug resistant strains, exhibits synergistic antibacterial effect with the use of Meropenem (HY-13678). NDM-1 inhibitor-8 exhibits anti-infectious activity in mouse models[1].

• HY-W653936

  Cephalexin-d5 hydrate	Inhibitor
  Cephalexin-d5 (hydrate) is deuterium labeled Cephalexin (monohydrate). Cephalexin (Cefalexin) monohydrate is a potent, orally active new semisynthetic cephalosporin antibiotic with a broad antibacterial spectrum. Cephalexin (Cefalexin) monohydrate has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria. Cephalexin (Cefalexin) monohydrate targets penicillin-binding proteins (PBPs) to inhibit bacterial cell wall assembly. Cephalexin (Cefalexin) monohydrate is used for the research of pneumonia, strep throat, and bacterial endocarditis, et al[1][2][3].

• HY-P5688

  Maximin 68	Inhibitor
  Maximin 68 is an antimicrobial peptide. Maximin 68 has antibacterial activity against C. albicans, S. aureus, E. coli, B. subtilis (MIC: 18.8, 9.4, 37.5, 9.4 μg/mL). Maximin 68 has hemolytic activities against human and rabbit red cells[1].

• HY-155357

  Antibacterial agent 160	Inhibitor
  Antibacterial agent 160 is a potent antibacterial agents. Antibacterial agent 160 can rapidly kill bacterial and inhibits bacterial biofilm formation. Antibacterial agent 160 affects the normal function of DNA and leads cell death[1].

• HY-136069

  Xeruborbactam	Inhibitor
  Xeruborbactam (QPX7728) is a potent, ultra-broad-spectrum boronic acid beta-lactamase inhibitor. Xeruborbactam inhibits key serine and metallo beta-lactamases at a nano molar range[1].

• HY-B0117A

  Tigecycline hydrochloride	Inhibitor
  Tigecycline hydrochloride (GAR-936 hydrochloride) is a broad-spectrum glycylcycline antibiotic. The mean inhibitory concentration (MIC) of Tigecycline for E. coli (MG1655 strain) is approximately 125 ng/mL[1]. MIC50 and MIC90 are 1 and 2 mg/L for Acinetobacter baumannii (A. baumannii), respectively[2].

• HY-151165R

  LasR-IN-3 (Standard)	Inhibitor
  Quinizarin (Standard) is the analytical standard of Quinizarin. This product is intended for research and analytical applications. Quinizarin (1,4-Dihydroxyanthraquinone), a part of the anticancer agents such as Doxorubicin, Daunorubicin, and Adriamycin, interacts with DNA by intercalating mode (Kd=86.1 μM). Quinizarin is used as a fungicide and pesticide chemical and has shown the ability to inhibit tumor cell growth[1][2].

• HY-N12851

  4-OHE	Inhibitor
  4-OHE ((E)-4-Oxo-2-hexenal) is a mutagen formed by the peroxidation of omega-3 fats. 4-OHE has antibacterial activity[1][2].

• HY-120009

  Showdomycin	Inhibitor
  Showdomycin is an antibiotic produced by IM-2-induced in Streptomyces[1].

• HY-N2575R

  Hypocrellin A (Standard)	Inhibitor

• HY-D1005A8

  Poloxamer 181 (L61)	Inhibitor
  Poloxamer 181 L61 is block polymer of polyoxyethylene and polyoxypropylene with average molecular mass of 2000. Poloxamer 181 L61 exhibits antimicrobial activity, that inihibits 91% Mycobacterium avium complex at concentration of 1 mg/mL. Poloxamer 181 L61 forms thermoreversible hydrogel, that is utilized in food additives, drug delivery carriers in cosmetics, pharmaceutical ingredients and tissue engineering[1][2].

• HY-155007

  DNA gyrase B-IN-2		99.77%
  DNA gyrase B-IN-2 (Compound E) is a 2-aminobenzothiazole-based DNA gyrase B inhibitor with promising activity against ESKAPE bacterial pathogens. DNA gyrase B-IN-2 showed low nanomolar inhibition of DNA gyrase (IC50 < 10 nM) and broad-spectrum antibacterial activity against pathogens belonging to the ESKAPE group, with the minimum inhibitory concentration < 0.03 μg/mL for most Gram-positive strains and 4–16 μg/mL against Gram-negative E. coli, Acinetobacter baumannii, Pseudomonas aeruginosa, and Klebsiella pneumoniae.DNA gyrase B-IN-2 can be used for the research of infection[1].

• HY-W017241

  1-Naphthalenemethanol	Inhibitor
  1-Naphthalenemethanol is a natural compound the root bark extracts of Annona senegalensis with antibacterial activity[1].

• HY-P5649

  PhD3	Inhibitor
  PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans[1].

• HY-A0111

  Cefetamet		99.42%
  Cefetamet is a cephalosporin antibiotic. Cefetamet has the potential for the research of both upper and lower community-acquired respiratory tract infections[1].

• HY-122518

  8-Deazafolic acid	Inhibitor
  8-Deazafolic acid is an antimicrobial drug for the folate-dependent bacteria, Streptococcus faecium (ATCC 8043) and Lactobacillus casei (ATCC 74691). 8-Deazafolic acid has activity against lymphoid leukemia L1210 in mice[1].

• HY-B0226

  Nitrofurazone	Inhibitor	99.86%
  Nitrofurazone (Nitrofural) is a broad spectrum antibiotic that has oral activity. Nitrofurazone is a nitro-aromatic drug. Nitrofurazone is active against both Gram-positive and Gram-negative bacteria[1][2][3][4][5].

• HY-W020183

  γ-Terpinene	Inhibitor
  γ-Terpinene, a monoterpene, is an orally active antioxidant compound which can scavenge radicals directly. γ-Terpinene has potent antinociception activity. γ-Terpinene exhibits antimicrobial efficacy against various bacteria and fungi[1][2].

• HY-163069

  Antitubercular agent-43	Inhibitor
  Antitubercular agent-43 (compound A11) is an orally active and potent antitubercular agent. Antitubercular agent-43 shows highly metabolic stability against human and mouse cytochrome P450 enzymes. Antitubercular agent-43 exhibits bactericidal efficacy in acute TB infection mouse model[1].

• HY-162496

  L-NBDNJ	Inhibitor
  L-NBDNJ, a glycomimetic, is an antivirulence agent. L-NBDNJ interferes with the expression of proteins regulating cytoskeleton assembly and organization of the host cell. L-NBDNJ has anti-inflammatory and anti-infective effects in models of cystic fibrosis (CF) lung disease infection[1].

• HY-N2329

  Piperlongumine	Inhibitor
  Piperlongumine is a alkaloid[1], possesses ant-inflammatory, antibacterial, antiangiogenic, antioxidant, antitumor, and antidiabetic activities[2]. Piperlongumine induces ROS, and induces apoptosis in cancer cell lines[1]. Piperlongumine shows anti-cardiac fibrosis activity, suppresses myofibroblast transformation via suppression of the ERK1/2 signaling pathway. Piperlongumin could be used in the study of migrasome[2][3].

• HY-126696

  Altromycin D	Inhibitor
  Altromycin D is a Gram-positive antibiotic[1].

• HY-W250308A

  ε-Poly-L-lysine (hydrochloride) (MV 2000-5000)	Inhibitor
  ε-Poly-L-lysine hydrochloride (MV 2000-5000) is an antimicrobial peptide that can be produced by bacteria such as Streptomyces. Epsilon-polylysine hydrochloride inhibits the growth of microorganisms such as bacteria, yeasts and molds and is therefore often used as a green food additive and preservative in various food and beverage products. Epsilon-polylysine hydrochloride has a variety of properties, including thermal stability, resistance to acidic conditions, and broad-spectrum antimicrobial activity. Epsilon-polylysine hydrochloride can be loaded on other materials to form nanoparticles or form nanofiber membranes for targeted delivery to exert sustained antibacterial efficacy. Epsilon-polylysine hydrochloride is also used as a liposome stabilizer[1][2][3][4].

• HY-B0455B

  Lomefloxacin (aspartate)	Inhibitor
  Lomefloxacin (SC47111A) aspartate is a broad-spectrum quinolone antibiotic, with antimicrobial activity. Lomefloxacin aspartate can be used for researching respiratory tract infections, genitourinary infections, gastrointestinal infections, ENT infections, etc.[1][2].

• HY-100593A

  Spiramycin (hexanedioate)	Inhibitor
  Spiramycin hexanedioate (Rovamycin) is a macrolide antibiotic produced by Streptomyces ambofaciens with against bacteria and Toxoplasma gondii activities, and also has antiparasitic effect. Spiramycin hexanedioate is composed of a 16-member lactone ring, on which three sugars (mycaminose, forosamine, and mycarose) are attached[1][2].

• HY-B0113S

  Omeprazole-d3	Inhibitor
  Omeprazole-d3 is deuterium labeled Omeprazole. Omeprazole, a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM[1]. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria[2].

• HY-136070

  QPX7728 bis-acetoxy methyl ester	Inhibitor
  QPX7728 bis-acetoxy methyl ester is a boronic acid β-lactamase inhibitor, exacted from WO2018005662A1, compound 42[1].

• HY-50908

  Ridaforolimus
  Ridaforolimus (MK-8669) is a potent and selective mTOR inhibitor; inhibits ribosomal protein S6 phosphorylation with an IC50 of 0.2 nM in HT-1080 cells[1].

• HY-146701

  MtTMPK-IN-7	Inhibitor
  MtTMPK-IN-7 (compound 26) is a moderate M. tuberculosis thymidylate kinase (MtbTMPK) inhibitor with an IC50 value of 47 μM. MtTMPK-IN-7 has sub-micromolar activity against mycobacteria (MICs = 2.3~4.7 μM) without significant cytotoxicity. MtTMPK-IN-7 can be used for researching tuberculosis[1].

• HY-17025S

  Rifabutin-d7	Inhibitor
  Rifabutin-d7 is the deuterium labeled Rifabutin. Rifabutin (Ansamycin) is a semisynthetic ansamycin antibiotic with potent antimycobacterial properties. Rifabutin inhibits DNA-dependent RNA polymerase.

• HY-B0522B

  Ampicillin trihydrate	Inhibitor	99.93%
  Ampicillin trihydrate (D-(-)-α-Aminobenzylpenicillin trihydrate) is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria.

• HY-168844

  Antibacterial agent 259	Inhibitor
  Antibacterial agent 259 (K3) is a bactericide, with EC50 values ​​of 1.5, 1.7 and 4.9 mg/L for Xoo, Xoc and Xac, respectively. Antibacterial agent 259 can induce pathogens to produce reactive oxygen species (ROS), leading to their death. Antibacterial agent 259 can be used in the prevention and control of plant bacterial diseases[1].

• HY-157618

  18:0-18:1 PG sodium
  18:0-18:1 PG sodium is a hydrogenated phospholipid that contributes to the stability of photosystem I and II protein complexes and plays a role in bacterial defense mechanisms, featuring two extra methylene groups in its saturated sn-1 chain, and is present in the thylakoid membranes of higher plants and cyanobacteria.

• HY-17522

  Meptyldinocap	Inhibitor	99.91%
  Meptyldinocap (2,4-DNOPC) is a novel powdery mildew (Erysiphe necator) fungicide which shows protectant and post-infective activities.

• HY-152249

  Antibacterial agent 131	Inhibitor	98.52%
  Antibacterial agent 131 is a quinoline derivative. Antibacterial agent 131 has antimicrobial effect. Antibacterial agent 131 destroys the integrity of the fungal cells via blocking ergosterol production[1].

• HY-105033

  Irloxacin	Inhibitor	98.49%
  Irloxacin (Pirfloxacin) is a quinolone antibacterial agent. Irloxacin shows greater activity with an acid pH. Irloxacin has a good in vitro antimicrobial spectrum against both gram-positive and gram-negative bacteria. Orally active[1].

• HY-P2328

  Gramicidin C	Inhibitor
  Gramicidin C is a naturally occuring polypeptide antibiotic isolated from B. brevis var. G.B.[1]

• HY-146330

  FtsZ-IN-2	Inhibitor
  FtsZ-IN-2 (Compound 19) is an inhibitor of the bacterial cell division protein FtsZ with GTPase inhibitory activity. FtsZ-IN-2 exhibits anti-staphylococcal activity with MIC values of 2 µg/ml for MSSA and MRSA[1].

• HY-144281

  MsbA-IN-3	Inhibitor
  MsbA-IN-3 (compound 31) is a potent and highly selective MsbA inhibitor with an IC50 value of 2 nM. MsbA-IN-3 has inhibitory activity against Escherichia coli with a MIC of 35 μM[1].

• HY-14137S

  Rimonabant-d10 hydrochloride	Inhibitor
  Rimonabant-d10 (hydrochloride) is the deuterium labeled Rimonabant hydrochloride. Rimonabant hydrochloride (SR 141716A hydrochloride) is a highly potent and selective central cannabinoid receptor (CB1) antagonist with an Ki of 1.8 nM. Rimonabant hHydrochloride (SR 141716A Hydrochloride) also inhibits Mycobacterial membrane protein Large 3 (MMPL3)[1][2].

• HY-149610

  Antibacterial agent 156	Inhibitor
  Antibacterial agent 156 (Compound 57) is a selective and potent bactericidal against C. difficile and targets cell-wall synthesis. Antibacterial agent 156 exhibits bactericidal activity with the minimal inhibitory concentration of 0.5 μg/mL and 1 μg/mL against MIMIC50 (101 strains) and MIC90 (101 strains)[1].

• HY-W013766

  Pipemidic acid trihydrate	Inhibitor
  Pipemidic acid trihydrate, a derivative of Piromidic acid, is an antibacterial agent. Pipemidic acid trihydrate inhibits DNA gyrase. Pipemidic acid trihydrate is active against gram-negative bacteria including Pseudomonas aeruginosa as well as some gram-positive bacteria. Pipemidic acid trihydrate can be used for the research of intestinal, urinary, and biliary tract infections[1][2].

• HY-N5009

  Thermopsine	Inhibitor	99.43%
  Thermopsine is a quinolizidine alkaloid isolated from the fruits and pods and stem bark of Sophora velutina subsp. Thermopsine has antibacterial activity[1].

• HY-B0395DS

  (1R,2S,7R)-Sitafloxacin-d4 hydrochloride
  (1R,2S,7R)-Sitafloxacin-d4 (hydrochloride) is deuterium labeled (R)-Sitafloxacin.

• HY-17006A

  Caspofungin
  Caspofungin is a potent antifungal agent. Caspofungin inhibits the synthesis of the fungal cell wall component β-(l,3)-D-glucan[1][2].

• HY-125365R

  Rifamycin S (Standard)	Inhibitor
  Rifamycin S (Standard) is the analytical standard of Rifamycin S. This product is intended for research and analytical applications. Rifamycin S, a quinone, is an antibiotic against Gram-positive bacteria (including MRSA). Rifamycin S is the oxidized forms of a reversible oxidation-reduction system involving two electrons. Rifamycin S generates reactive oxygen species (ROS) and inhibits microsomal lipid peroxidation. Rifamycin S can be used for tuberculosis and leprosy[1][2][3].

• HY-W337872

  N-(3-Hydroxyoctanoyl)-L-homoserine lactone	Inhibitor
  N-(3-Hydroxyoctanoyl)-L-homoserine lactone (compound 11), a hydroxyl-containing N-acyl l-homoserine lactone (AHL) ligand, is a competitive AbaR and LasR inhibitor[1].

• HY-100385R

  Brevianamide F (Standard)	Inhibitor
  Rebaudioside C (Standard) is the analytical standard of Rebaudioside C. This product is intended for research and analytical applications. Rebaudioside C (Dulcoside B) is a natural sweetener that can be used in controlled diets for diabetic patients.

• HY-108191

  Paldimycin A	Inhibitor
  Paldimycin A (Antibiotic 273a1α) is an antibiotic derived from Streptomyces paulus, primarily targeting Gram-positive bacteria. Paldimycin A exerts its antibacterial effects by interfering with bacterial protein synthesis and cell membrane function[1][2].

• HY-168674

  Antibacterial agent 255	Inhibitor
  Antibacterial agent 255 (compound (±)-1) is a potent antibacterial agent. Antibacterial agent 255 is a potent and selective 4-diphosphocytidyl-2-C-methyl-D-erythritol (IspE) inhibitor with IC50 values of 13.0, 8.0, 20 µM for EclspE, KplspE, AblspE, respectively[1].

• HY-N3661

  (24S)-Cycloartane-3β,24,25-triol	Inhibitor
  (24S)-Cycloartane-3β,24,25-triol, a cycloartane, has antitubercular activity against Mycobacterium tuberculosis H37Rv (MIC: 32 μg/mL). (24S)-Cycloartane-3β,24,25-triol can be isolated from the flowers of Chrysanthemum morifolium[1].

• HY-30219

  D-​(+)​-​Phenyllactic acid	Inhibitor	99.93%
  D-​(+)​-​Phenyllactic acid is an anti-bacterial agent, excreted by Geotrichum candidum, inhibits a range of Gram-positive from humans and foodstuffs and Gram-negative bacteria found in humans[1].

• HY-162761

  COX-1/2-IN-9	Inhibitor
  COX-1/2-IN-9 (Compound 3n) is a potent and selective inhibitor of COX-1/2, with IC50 values of 0.031 µM and 0.01 µM, respectively. COX-1/2-IN-9 possesses both antibacterial and anti-inflammatory activities, effectively inhibiting MRSA 1478 (MIC=50 μg/mL) and multidrug-resistant S. lentus (MIC=50 μg/mL). COX-1/2-IN-9 holds significant potential to alleviate MRSA-induced pneumonia in immunocompromised states[1].

• HY-134041

  Phloroglucide	Inhibitor	98.16%
  Phloroglucide is a natural product that can be isolated from ferns[1].

• HY-P5206

  Garvicin KS, GakB	Inhibitor
  Garvicin KS, GakB is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS, GakB with GakA, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA[1].

• HY-121620

  Monolaurin	Inhibitor	99.26%
  Monolaurin (1-Monolaurin) is an orally active antibiotic with antiviral and antibacterial properties[1][2][3].

• HY-113678

  Colistin	Inhibitor
  Colistin (Polymyxin E) is an orally active polypeptide antibiotic. Colistin has excellent activity against various Gram-negative rod-shaped bacteria, including multidrug-resistant Pseudomonas aeruginosa, Acinetobacter baumannii and Klebsiella pneumoniae. Colistin is associated with nephrotoxicity. Colistin can be used for the research of infections caused by Gram-negative bacilli[1][2].

• HY-B0925

  Oxacillin sodium salt	Inhibitor
  Oxacillin sodium salt is an orally active synthetic penicillin with good bactericidal activity against staphylococci and other gram-positive pathogens[1].

• HY-N1735

  2′-Hydroxygenistein	Inhibitor
  2′-Hydroxygenistein is a natural product that can be isolated from Crotalaria pallida and C. assamica. 2′-Hydroxygenistein shows anti-inflammatory activity. 2′-Hydroxygenistein shows significant concentration-dependent inhibitory effects on the release of β-glucuronidase and lysozyme from rat neutrophils, with IC50 values of 5.9 ± 1.4 and 9.7 ± 3.5 μM, respectively[1].

• HY-122643

  NITD-916	Inhibitor	99.83%
  NITD-916, a 4-hydroxy-2-pyridone derivative, is an orally active and highly lipophilic mycobacterial enoyl reductase InhA inhibitor with an IC50 of 570 nM. NITD-916 forms a ternary complex with InhA and NADH to block access to the fatty acyl substrate binding pocket. NITD-916 has potent anti-tuberculosis effects[1][2].

• HY-B0276A

  Ethionamide hydrochloride	Inhibitor
  Ethionamide hydrochloride (2-Ethylthioisonicotinamide hydrochloride) is an antituberculosis drug with mycobacterial activity. Ethionamide hydrochloride interferes with the bacterial cell wall synthesis process by inhibiting the synthesis of fatty acids in the bacterial cell wall. Ethionamide hydrochloride may have bacteriostatic or bactericidal effects, depending on the concentration of the drug at the site of infection and the susceptibility of the associated microorganisms. Ethionamide hydrochloride combines with NAD+ to form an adduct, thereby exerting its antibacterial effect[1].

• HY-158242

  Antibacterial agent 212	Inhibitor
  Antibacterial agent 212 (Compound 162) is an antibacterial agent with oral activity and good pharmacokinetic properties, having a MIC of 4 μg/mL against Pseudomonas aeruginosa T-2022-D2-048[1].

• HY-168100

  LpxC-IN-14	Inhibitor
  LpxC-IN-14 (compound 6i) is a potent LpxC inhibitor. LpxC-IN-14 shows antibacterial activity. LpxC-IN-14 shows low cytotoxicity. LpxC-IN-14 shows acceptable plasma protein binding[1].

• HY-P5607

  Bombinin	Inhibitor
  Bombinin is an antimicrobial peptide derived from frog Bombina variegata. Bombinin has a protective effect on aminopeptidase[1].

• HY-W728085

  CPPD-Q	Inhibitor
  CPPD-Q is an antimicrobial agent and insecticide. CPPD-Q has an EC50 of 6.98 mg/L against Vibrio fischeri. At doses of 1 or 10 µg/mL, CPPD-Q exerts its insecticidal effect by inducing the production of reactive oxygen species (ROS) in the intestines of Caenorhabditis elegans[1][2].

• HY-U00194

  Vebufloxacin	Inhibitor
  Vebufloxacin (Flumenique; OPC7241; DM8966) exhibits potent antibacterial activity against gram-positive and -negative bacteria.

• HY-136348

  ML338	Inhibitor
  ML338 is a selective small molecule inhibitor probe of non-replicating Mycobacterium tuberculosis bacilli and is against the non-replicating M. tuberculosis with IC90 and IC99 values of 1 μM and 4 μM, respectively by CFU. ML338 is a invaluable tool for identifying both essential functions and vulnerabilities of the M. tuberculosis bacilli in the nutrient deprivation states. ML338 can be used for the study of M. tuberculosis chemotherapy[1].

• HY-125653

  Kapurimycin A2	Inhibitor
  Kapurimycin A2 is an antitumor antibiotic that can be found in the culture of Streptomyces sp.. Kapurimycin A2 is an active against bacteria, particularly Gram-positive organisms[1].

• HY-N10282

  Isodihydroauroglaucin	Inhibitor
  Isodihydroauroglaucin, a fungal metabolite, shows antibacterial activity[1].

• HY-169219

  DK06	Inhibitor
  DK06 (compund DK06) inhibits the growth of Listeria monocytogenes, disrupts biofilm formation and reduces extracellular polymeric substances[1].

• HY-136429A

  Ethylhydrocupreine hydrochloride	Inhibitor	99.72%
  Ethylhydrocupreine hydrochloride (Optochin hydrochloride) is a quinine derivate with antimicrobial activity against S. pneumoniae. Ethylhydrocupreine hydrochloride also possesses antimalarial activity against Plasmodium falciparum, with an IC50 of 25.75 nM. Ethylhydrocupreine hydrochloride is a Gallus gallus taste 2 receptors (ggTas2r1, ggTas2r2 and ggTas2r7) agonist[1][2][3][4].

• HY-112176R

  Kanosamine hydrochloride (Standard)	Inhibitor
  6-Hydroxytropinone (Standard) is the analytical standard of 6-Hydroxytropinone. This product is intended for research and analytical applications. 6-Hydroxytropinone is a Alkaloids product that can be isolated from the roots of Atropa belladonna[1].

• HY-W034067

  Silver nitrite
  Silver nitrite is an inorganic compound with the chemical formula AgNO2. Silver nitrite can inhibit cell division and bacterial growth by interfering with protein synthesis[1].

• HY-19050

  BRL-42715	Inhibitor
  BRL-42715 is a potent inhibitor of a broad range of bacterial beta-lactamases (β-lactamase) [1].

• HY-B0883

  Proflavine hemisulfate	Inhibitor	98.45%
  Proflavine hemisulfate, an acridine dye, is a known DNA intercalating agent. Anti-microbial agent[1]. Proflavine hemisulfate behaves as a pore blocker for Kir3.2. Proflavine hemisulfate is a potential lead compound for Kir3.2-associated neurological diseases[2].

• HY-B1056

  Procodazole	Inhibitor	99.73%
  Procodazole is an orally active enhancer and a non-specific active immune protector against viral and bacterial infections. Procodazole also exhibits antiparasitic activity. In addition, Procodazole is a carbonic anhydrase inhibitor with antitumor activity[1][2].

• HY-B1907R

  Rifamycin (sodium) (Standard)	Inhibitor
  Rifamycin (sodium) (Standard) is the analytical standard of Rifamycin (sodium). This product is intended for research and analytical applications. Rifamycin sodium (Rifamycin SV monosodium) belongs to the family of ansamycin antibiotics and has been isolated from the fermentation of A. mediterranei or its mutants. Rifamycin sodium displays a broad spectrum of antibiotic activity against Gram-positive and, to a lesser extent, Gram-negative bacteria[1].

• HY-P0270

  Magainin 2	Inhibitor	98.92%
  Magainin 2 (Magainin II) is an?antimicrobial?peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa[1]. Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes[2].

• HY-125066

  Reveromycin B
  Reveromycin B is a spiroketal bacterial metabolite originally isolated from Streptomyces. It inhibits EGF-induced mitogenic activity in Balb/MK cells (IC50=6 μg/mL) and exhibits pH-dependent antifungal activity against C. albicans (MICs=15.6 and >500 μg/mL at pH 3.0 and 7.4, respectively). Unlike reveromycin A and reveromycin C, reveromycin B does not inhibit proliferation of KB and K562 cells.

• HY-W130901

  5-Phenyl-1-pentyne
  5-Phenyl-1-pentyne (Pent-4-ynylbenzene) is a compound with antibacterial and antitumor activity, which can effectively inhibit the growth of certain cancer cells. 5-Phenyl-1-pentyne is often used as a reaction intermediate in organic synthesis to promote a variety of chemical reactions. 5-Phenyl-1-pentyne is also used in the synthesis of new compounds to improve the bioavailability and inhibitory effect of the compounds.

• HY-167906

  Lunamarine
  Lunamarine is a inhibitor of PDE5 with BBB permeability. Lunamarine can be used in the reseach of Pulmonary Arterial Hypertension (PAH) and Erectile Dysfunction (ED)[1].

• HY-161937

  Antibacterial agent 236	Inhibitor
  Antibacterial agent 236 (Compound 4l) is an orally active inhibitor for DNA gyrase and topoisomerase IV (IC50 is 3.2 and 300 nM in Staphylococcus aureus), and exhibits board-spectrum antibacterial activity. Antibacterial agent 236 exhibits good pharmacokinetic properties in mice[1].

• HY-155973

  Urease-IN-8	Inhibitor
  Urease-IN-8 (Compound 5e) is a competitive Urease inhibitor (IC50: 3.51 μM, Ki: 3.11 μM). Urease-IN-8 can be used for research of peptic and gastric ulcers[1].

• HY-14865BR

  Omadacycline (tosylate) (Standard)	Inhibitor
  Omadacycline (tosylate) (Standard) is the analytical standard of Omadacycline (tosylate). This product is intended for research and analytical applications. Omadacycline (PTK 0796) tosylate, a first-in-class orally active aminomethylcycline antibacterial, is a member of the tetracycline class of antibiotics. Omadacycline tosylate acts through the inhibition of bacterial protein synthesis by binding to the 30S ribosomal subunit. Omadacycline tosylate possesses broad-spectrum antibacterial activity against aerobic and anaerobic Gram-positive and Gram-negative bacteria, as well as atypical bacteria. Omadacycline tosylate can be used for the research of acute bacterial skin and skin-structure infections, community-acquired pneumonia, and urinary tract infections[1][2][3][4].

• HY-B0134B

  Bestatin trifluoroacetate	Inhibitor
  Bestatin trifluoroacetate is an inhibitor of CD13 (Aminopeptidase N)/APN and leukotriene A4 hydrolase, used for cancer research.

• HY-151599

  Pks13-TE inhibitor 3	Inhibitor
  Pks13-TE inhibitor 3 (compound 23) is a 13-Thioesterase (Pks13-TE) inhibitor (IC50=1.55 μM). Pks13-TE inhibitor 3 shows good anti-tuberculosis activity against both agent-sensitive and drug-resistant Mtb strains (MIC=0.0625-0.25 μg/mL). Pks13-TE inhibitor 3 can be used in studies of multidrug-resistant TB and extensively drug-resistant TB[1].

• HY-112861A

  Gln-AMS TFA	Inhibitor	99.65%
  Gln-AMS (TFA) is a type Ia aminoacyl-tRNA synthetase (AARS) inhibitor. Gln-AMS inhibits glutaminyl-tRNA synthetase (GlnRS) with a Ki of 1.32 µM.

• HY-128850S5

  N-Acetyl-D-mannosamine-15N
  N-Acetyl-D-mannosamine-15N is the 15N labeled N-Acetyl-D-mannosamine. N-Acetyl-D-mannosamine (ManNAc) is an essential precursor of N-acetylneuraminic acid (NeuAc), the specific monomer of bacterial capsular polysialic acid (PA)[1][2]

• HY-123024

  Cefatrizine	Inhibitor
  Cefatrizine (BL-S-640) is an orally active and broad-spectrum cephalosporin antibiotic. Cefatrizine is also a eEF2K inhibitor, with anti-proliferative activity in human breast cancer cells, which could induce ER stress, leading to cell death. Cefatrizine can be used in studies of cancer and bacterial infection[1][2].

• HY-B2170A

  Octenidine dihydrochloride	Inhibitor
  Octenidine dihydrochloride is an effective antiseptic compound for skin mucous membranes and wounds.

• HY-123319A

  Antofloxacin	Inhibitor
  Antofloxacin is a well tolerate, orally active and broad-spectrum 8-amino-fluoroquinolone with potent antibacterial activities. Antofloxacin shows superior antibacterial activity against gyrA mutation-positive H. pylori strains, especially in Asn87- mutated strains, compared to levofloxacin. Antofloxacin is a weak, reversible inhibitor of CYP1A2 for the research of infections caused by a diverse group of bacterial species[1][2][3].

• HY-15230

  Geldanamycin	Inhibitor
  Geldanamycin is a Hsp90 inhibitor with antimicrobial activity against many Gram-positive and some Gram-negative bacteria. Geldanamycin has anti-influenza virus H5N1 activities.

• HY-108939

  Aminoacyl tRNA synthetase-IN-1	Inhibitor	99.80%
  Aminoacyl tRNA synthetase-IN-1 is a bacterial aminoacyl tRNA synthetase (aaRS) inhibitor.

• HY-N3373

  Loganetin		98.51%
  Loganetin is a non-toxic natural product that may be applied in the antibacterial agent development for treating multidrug-resistant Gram negative infections.

• HY-N13985

  Arylomycin B6	Inhibitor
  Arylomycin B6 is a lipohexapeptide antibiotic against Gram-positive bacteria[1].

• HY-N3920

  Gancaonin G	Inhibitor	98.73%
  Gancaonin G is a 6-prenylated isoflavanone that can be isolated from Glycyrrhiza uralensis. Gancaonin G has antibacterial activity against Streptococcus mutants and MRSA strains[1].

• HY-124923R

  Lupulone (Standard)	Inhibitor
  Lupulone (Standard) is the analytical standard of Lupulone. This product is intended for research and analytical applications. Lupulone is a beta-acid from the hop plant H. lupulus with diverse biological activities including antibacterial, antioxidant, and anticarcinogenic properties[1][2][3].

• HY-N1944S

  Nerolidol-d4	Inhibitor
  Nerolidol-d4 is deuterated labeled Tenuazonic acid (HY-N6715). Tenuazonic acid, belonging to tetramic acids that are the largest family of natural products, is a putative nonhost-selective mycotoxin isolated from Alternaria alternate[1]. Tenuazonic acid blocks electron transport beyond primary quinone acceptor (QA) by interacting with D1 protein and it is a broad-spectrum and effective photosystem II (PSII) inhibitor[2].

• HY-N1181

  Tamarixetin	Inhibitor	99.31%
  Tamarixetin (4'-O-Methyl Quercetin) is an orally active natural flavonoid derivative of quercetin and caseinolytic protease p (ClpP) inhibitor with anti-inflammatory, antioxidant and antitumor effects. Tamarixetin inhibits the hydrolytic activity of ClpP to the fluorescent substrate Suc-LY-AMC with an IC50 of 49.73 μM, which can be used for the study of Staphylococcus aureus infection. Tamarixetin inhibits tumor cell growth, induces apoptosis, and cell cycle arrest. Tamarixetin prevents cardiac hypertrophy by inhibiting the NFAT and AKT pathways[1][2][3][4].

• HY-120315

  Nyssoside	Inhibitor
  Nyssoside, a ellagic acid derivative, has significant antioxidant activity and shows antibacterial activity against different pathogenic bacteria[1].

• HY-P1513

  LL-37 scrambled peptide	Inhibitor
  LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

• HY-B0467AR

  Amoxicillin (Standard)	Inhibitor
  Amoxicillin (Standard) is the analytical standard of Amoxicillin. This product is intended for research and analytical applications. Amoxicillin (Amoxycillin) is an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth[1][2][3].

• HY-17381A

  Idarubicin	Inhibitor
  Idarubicin is an orally active and potent anthracycline antileukemic agent. Idarubicin inhibits the topoisomerase II interfering with the replication of DNA and RNA transcription. Idarubicin shows induction of DNA damage. Idarubicin inhibits DNA synthesis and of c-myc expression. Idarubicin inhibits the growth of bacteria and yeasts[1][2][3][4][5].

• HY-B1436

  Nifuroxazide	Inhibitor	99.90%
  Nifuroxazide is an effective inhibitor of STAT3, also exerts potent anti-tumor and anti-metastasis activity. Nifuroxazide is an orally active nitrofuran antibiotic.

• HY-146328

  PqsR/LasR-IN-2	Inhibitor	98.54%
  PqsR/LasR-IN-2 (Compound 3) is a potent inhibitor of PqsR and LasR systems in P. aeruginosa. PqsR/LasR-IN-2 also inhibits hERG with the IC50 of 1.408 µM[1].

• HY-A0166AR

  Cilastatin (sodium) (Standard)	Inhibitor

• HY-N14257

  Andrimid	Inhibitor
  Andrimid is a pseudopeptide antibiotic with polyketide-nonribosomal peptide hybrid products (PK-NRPs). Andrimid blocks the carboxyl-transfer reaction of bacterial acetyl-CoA carboxylase (ACC) and inhibits fatty acid biosynthesis in bacteria. Andrimid can be widely used in biomedicine and bio-agriculture[1].

• HY-158682

  LpxC-IN-13	Inhibitor
  LpxC-IN-13 (Compound 13) is a LpxC inhibitor, with an IC50 18.06 nM. LpxC-IN-13 effectively inhibits Gram-negative bacterial infection[1].

• HY-B0712B

  Ceftriaxone sodium salt	Inhibitor	99.90%
  Ceftriaxone sodium salt (Ro 13-9904) is a broad spectrum β-lactam third-generation cephalosporin antibiotic, which has good antibacterial activity against a variety of gram-negative and positive bacteria. Ceftriaxone sodium salt is a covalent inhibitor of GSK3β with IC50 value of 0.78 μM. Ceftriaxone sodium salt is an inhibitor of Aurora B. Ceftriaxone sodium salt has anti-inflammatory, antitumor and antioxidant activities. Ceftriaxone sodium salt can be used in the study of bacterial infections and meningitis[1][2][3][4][5][6][7].

• HY-P5589

  Plantaricin A	Inhibitor	99.45%
  Plantaricin A is an antimicrobial peptide derived from LactobacifZus plantarum against bacteria[1].

• HY-113289

  Brassicasterol	Inhibitor	98.71%
  Brassicasterol is a metabolite of Ergosterol and has cardiovascular protective effects. Brassicasterol exerts anticancer effects in prostate cancer through dual targeting of AKT and androgen receptor signaling pathways. Brassicasterol inhibits HSV-1 (IC50=1.2 μM) and Mycobacterium tuberculosis. Brassicasterol also inhibits sterol δ 24-reductase, slowing the progression of atherosclerosis. Brassicasterol is also a cerebrospinal fluid biomarker for Alzheimer's disease[1][2][3][4][5][6].

• HY-100531

  DprE1-IN-2	Inhibitor	99.59%
  DprE1-IN-2 (compound 18) is a potent DprE1 inhibitor with an IC50 of 28 nM. DprE1-IN-2 has antituberculosis effect[1].

• HY-16487R

  Temafloxacin (Standard)	Inhibitor
  Temafloxacin (Standard) is the analytical standard of Temafloxacin. This product is intended for research and analytical applications. Temafloxacin (TMFX) is an orally active quinolone broad-spectrum antibacterial agent. Temafloxacin is well tolerated in lower respiratory and genitourinary tract infections[1][2].

• HY-116688

  2-Hydroxy-4-(methylthio)butyric acid	Activator
  2-Hydroxy-4-(methylthio)butyric acid is a dietary essential amino acid which is converted to Methionine (HY-13694) by 2-hydroxy acid dehydrogenase and 2-hydroxy acid oxidase. 2-Hydroxy-4-(methylthio)butyric acid is promising for research of gut disease[1].

• HY-128200

  Pseudomonas quinolone signal	Activator
  Pseudomonas Quinolone Signal (Compound C), a signaling molecule produced by Pseudomonas aeruginosa, can activate lasB. Pseudomonas Quinolone Signal can be used in the study of virulence regulation in Pseudomonas aeruginosa[1].

• HY-N0465S

  Olaquindox-d4	Inhibitor
  Olaquindox-d4 is the deuterium labeled Olaquindox (HY-N0465)[1]. Olaquindox, a quinoxalin derivative, is an orally active antibiotic. Olaquindox stimulates growth and decreases intestinal mucosal immunity of piglets[2].

• HY-A0089R

  Colistin (sulfate) (Standard)	Inhibitor
  Colistin (sulfate) (Standard) is the analytical standard of Colistin (sulfate). This product is intended for research and analytical applications. Colistin sulfate is a polypeptide antibiotic which inhibits gram-negative bacteria by binding to lipopolysaccharides and phospholipids in the outer cell membrane of gram-negative bacteria.

• HY-B0126

  Marbofloxacin	Inhibitor	99.79%
  Marbofloxacin is a third generation fluoroquinolone and orally active antimicrobial agent, which has a broad spectrum bactericidal activity and good efficacy. Marbofloxacin can be used for the research of infections by Gram-positive and Gram-negative bacteria and Mycoplasma[1][2][3].

• HY-N7010

  (-)-Corynoxidine	Inhibitor	99.90%
  (-)-Corynoxidine is an acetylcholinesterase inhibitor with an IC50 value of 89.0 μM, isolated from the aerial parts of Corydalis speciosa[1]. (-)-Corynoxidine exhibits antibacterial activities against Staphylococcus aureus and methicillin-resistant S. aureus strains in different degrees[2].

• HY-A0248BR

  Polymyxin B2 (Standard)	Inhibitor
  Obeticholic acid (Standard) is the analytical standard of Obeticholic acid. This product is intended for research and analytical applications. Obeticholic acid (INT-747) is a potent, selective and orally active FXR agonist with an EC50 of 99 nM. Obeticholic acid has anticholeretic and anti-inflammation effect. Obeticholic acid also induces autophagy[1][2][3].

• HY-B0616

  Cefepime Dihydrochloride Monohydrate	Inhibitor	99.99%
  Cefepime Dihydrochloride Monohydrate is a broad-spectrum cephalosporin with enhanced coverage against Gram-positive and Gram-negative bacteria[1].

• HY-146557

  Antitubercular agent-16	Inhibitor
  Antitubercular agent-16 (Compound 5q) is an antitubercular agent with MIC90 values of 0.40, 20.11, 23.51, 19.62, 10.93 and 13.62 μg/mL against M. tuberculosis H37Rv, CF16, CF61, CF76, CF152 and CF161, respectively. Antitubercular agent-16 shows low cytotoxicity against macrophages and pulmonary fibroblasts[1].

• HY-P1602

  Apidaecin IB	Inhibitor
  Apidaecin IB is a insect antimicrobial peptide, with minimum inhibitory concentration (MIC) values of 8 μM for E. coli (ML35, O18K1H7 and ATCC 25922).

• HY-N12171

  Isoreserpiline	Inhibitor
  Isoreserpiline is an orally active and BBB-penatrable indole alkaloids with antibacterial and antipsychotic activity. Isoreserpiline is even more effective when used in combination with antibiotics and inhibits the activity of bacterial efflux pumps. Isoreserpiline improves Amphetamine-induced hyperactivity in mice[1][2] .

• HY-N0195

  Azomycin	Inhibitor
  Azomycin (2-Nitroimidazole) is an antibiotic which can be active against aerobic Gram-positive and Gram-negative bacteria.

• HY-P10370

  d-(KLAKLAK)2, Proapoptotic Peptide	Inhibitor
  d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death)[1].

• HY-156980

  Podilfen	Inhibitor
  Podilfen is an active fraction of Delftia strains 2189 with antimicrobial effects[1].

• HY-111521

  Meropenem-vaborbactam	Inhibitor
  Meropenem-vaborbactam is an antibiotic against nonfermenting Gram-negative clinical isolates, including Enterobacteriaceae isolates with resistant and carbapenemase genotypes[1].

• HY-17452AR

  Cefditoren Pivoxil (Standard)	Inhibitor
  Cefditoren Pivoxil (Standard) is the analytical standard of Cefditoren Pivoxil. This product is intended for research and analytical applications. Cefditoren Pivoxil (ME 1207) is a broad-spectrum, third-generation, oral cephalosporin antibacterial with enhanced stability against many common β lactamases. Cefditoren Pivoxil has activity against Gram-negative organisms and Gram-positive organisms. Cefditoren Pivoxil can be used in the research of infection diseases such as acute exacerbations of chronic bronchitis, community-acquired pneumonia (CAP), streptococcal pharyngitis/tonsillitis, or uncomplicated skin and skin structure infections[1][2].

• HY-P1560

  Allergen Gal d 4 (46-61), chicken	Inhibitor
  Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.

• HY-10373B

  Trimetrexate isethionate	Inhibitor
  Trimetrexate (CI-898) isethionate is an antibiotic, also a potent and orally active dihydrofolate reductase (DHFR) inhibitor, reducing the production of DNA and RNA precursors and leading to cell death, with IC50 values of 4.74 nM and 1.35 nM for human DHFR and Toxoplasma gondii DHFR. Trimetrexate isethionate can also inhibit the growth of various cancer cells. Trimetrexate isethionate can be used for researching Pneumocystis carinii pneumonia (PCP) and cancer[1][2][3][4][5].

• HY-136150

  Methyl carnosate	Inhibitor	98.47%
  Methyl camosate is a diterpene isolated from Salvia officinalis or Rosmarinus officinalis. Methyl camosate has potent antioxidant and anti-bacterial activity[1][2].

• HY-N6746S1

  Citrinin-13C13	Inhibitor
  Citrinin-13C13 (NSC 186-13C13) is the 13C labeled Citrinin (HY-N6746). Citrinin (NSC 186) is a mycotoxin that causes food contamination and has different toxic effects. Citrinin is an effective oral anticancer agent. Citrinin has various regulatory effects on mouse immune system, including regulating the number of immune cells, inducing apoptosis and autophagy of immune cells, altering toll-like receptor expression and cytokine production. Citrinin can induce oxidative stress and lead to early apoptosis of oocytes. Low doses of Citrinin have neuroprotective effects against glutamate-induced excitotoxicity in rat cortical neurons. In addition, Citrinin also has antibacterial activity[1][2][3][4][5][6][7].

• HY-17390

  Loxapine	Inhibitor	99.93%
  Loxapine is an orally active dopamine inhibitor, 5-HT receptor antagonist and also a dibenzoxazepine anti-psychotic agent[1][4].

• HY-B0220D

  Erythromycin thiocyanate	Inhibitor
  Erythromycin thiocyanate is a macrolide antibiotic produced by actinomycete?Streptomyces erythreus?with a broad spectrum of antimicrobial activity. Erythromycin thiocyanate binds to bacterial 50S ribosomal subunits and inhibits?RNA-dependent protein synthesis?by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid[1][2]. Erythromycin thiocyanate also exhibits antitumor and neuroprotective effect in different fields of research[3][4].

• HY-137911

  Sparsomycin	Inhibitor
  Sparsomycin is a metabolite of the bacterium Streptomyces sparsogenes. Sparsomycin inhibits protein synthesis in both eukaryotic cells and bacteria. Sparsomycin inhibits the translation extension of ribosome PTC[1].

• HY-132823

  Ledaborbactam	Inhibitor	99.12%
  Iedaborbactam (VNRX-5236), as a β-lactamase inhibitor (WO2015191907, Example 62), can be used for the research of bacterial infections[1].

• HY-P5710

  LCI peptide	Inhibitor
  LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo[1].

• HY-B1159

  Nitroxoline	Inhibitor	99.90%
  Nitroxoline (8-Hydroxy-5-nitroquinoline), an antibiotic, is an orally active antibiofilm agent. Nitroxoline reduces the formation and induces the dispersal of Pseudomonas aeruginosa biofilms by chelation of iron and zinc. Nitroxoline can be used for the urinary tract infections and cancer research[1][2][3].

• HY-137975

  Exo2		99.96%
  Exo2 is a secretion inhibitor. Exo2 perturbs trafficking of Shiga toxin between endosomes and the trans-Golgi network. Exo2 blocks secretory cargo exit from the ER (endoplasmic reticulum) and disrupts the Golgi apparatus, but does not affect the morphology of the TGN (trans-Golgi network) Exo2 can stimulate calcium-dependent exocytosis in permeabilized adrenal chromaff in cells[1][2].

• HY-B1906R

  Streptomycin (Standard)	Inhibitor
  Streptomycin (Standard) is the analytical standard of Streptomycin. This product is intended for research and analytical applications. Streptomycin (Agrept) is an effective antibiotic against M. tuberculosis, is used for the research of tuberculosis (TB). Streptomycin also is a bacteriocidal agent that can be used for the research of a number of bacterial infections. Streptomycin can bind strongly to nucleic acids, interferes and blocks protein synthesis while permitting continued RNA and DNA synthesis. Streptomycin, as a common antibiotic used in culture media, also is a blocker of stretch-activated and mechanosensitive ion channels in neurons and cardiac myocytes [1][2][3].

• HY-135072

  N,N',N''-Triacetylchitotriose	Inhibitor
  N,N',N''-Triacetylchitotriose is a competitive inhibitor of lysozyme[1].

• HY-B0337S2

  Sulfadimethoxine-13C6	Inhibitor
  Sulfadimethoxine-13C6 is the 13C-labeled Sulfadimethoxine. Sulfadimethoxine (Sulphadimethoxine) is a sulfonamide antibiotic used to treat many infections[1][2].

• HY-B0467S

  Amoxicillin-d4	Inhibitor
  Amoxicillin-d4 is a deuterium labeled Amoxicillin. Amoxicillin is an antibiotic with good oral absorption and broad spectrum antimicrobial activity[1][2].

• HY-W716673R

  Ftivazide (Standard)	Inhibitor
  Ftivazide (Standard) is the analytical standard of Ftivazide. This product is intended for research and analytical applications. Ftivazide has anti-tuberculosis activity[1].

• HY-145147A

  AAA-10 formic	Inhibitor
  AAA-10 formic is an orally active gut bacterial bile salt hydrolases (BSH) inhibitor, with IC50s of 10 nM, 80 nM against B. theta rBSH and B. longum rBSH, respectively[1].

• HY-172220

  ChlaDUB1-IN-2	Inhibitor
  ChlaDUB1-IN-2 (Compound 27a) is the inhibitor for Chlamydia trachomatis deubiquitinase ChlaDUB1 with an IC50 of 0.97 μM. ChlaDUB1-IN-2 inhibits the inclusion body formation of C. trachomatis with an IIC50 of 25.6 μg/mL[1].

• HY-N6248

  Cowaxanthone B	Inhibitor
  Cowaxanthone B is a xanthone isolated from the fruits of Garcinia cowa. Cowaxanthone B has weak antibacterial activity[1].

• HY-132282

  Thiamphenicol glycinate hydrochloride	Inhibitor	99.29%
  Thiamphenicol glycinate hydrochloride is a broad-spectrum antibacterial agent that can be used for respiratory tract infections research[1].

• HY-14737R

  Ceftaroline fosamil (Standard)	Inhibitor

• HY-161689

  Antibacterial agent 220	Inhibitor
  Antibacterial agent 220 is a potent antibacterial agent that can directly destroy bacterial cell membranes. Antibacterial agent 220 effectively combats Gram-positive and and Gram-negative pathogens, including drug-resistant strains[1].

• HY-B0935R

  Benzyl benzoate (Standard)	Inhibitor
  Benzyl benzoate (Standard) is the analytical standard of Benzyl benzoate. This product is intended for research and analytical applications. Benzyl benzoate (Phenylmethyl benzoate) is an orally active anti-scabies agent, acaricide (EC50= 0.06 g/m2) and fungicide. Benzyl benzoate is an angiotensin II (Ang II) inhibitor with antihypertensive effects. Benzyl benzoate can be used in perfumes, pharmaceuticals and the food industry[1][2][3][4][5].

• HY-A0162A

  Quinupristin mesylate	Inhibitor
  Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits[1][2].

• HY-P5573

  Aurein 2.6	Inhibitor
  Aurein 2.6 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 25, 25, 30, 25, 30 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis)[1][2].

• HY-149305

  PptT-IN-4	Inhibitor
  PptT-IN-4 (Compound 3a) is a PptT inhibitor (IC50: 0.71 μM). PptT-IN-4 inhibits Mtb H37Rv with a MIC value of 42 μM. PptT-IN-4 also inhibits hERG, hCav1.2, and hNav1.5 channels with IC50s of 11 μM, 8.1 μM, 6.9 μM respectively[1].

• HY-B0438

  Spectinomycin dihydrochloride	Inhibitor
  Spectinomycin dihydrochloride is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin dihydrochloride acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin dihydrochloride is also a noncompetitive inhibitor of td intron RNA with an Ki value of 7.2 mM[1]-[5].

• HY-B1117R

  Cefoxitin (sodium) (Standard)	Inhibitor
  Cefoxitin (sodium) (Standard) is the analytical standard of Cefoxitin (sodium). This product is intended for research and analytical applications. Cefoxitin sodium (MK-306) is a cephamycin antibiotic, often grouped with the second generation cephalosporins, acts by interfering with cell wall synthesis, its activity spectrum includes a broad range of gram-negative and gram-positive bacteria.

• HY-B2157

  Robenidine hydrochloride	Inhibitor
  Robenidine hydrochloride is an anticoccidial agent which is also active against MRSA and VRE with MIC50s of 8.1 and 4.7 μM, respectively.

• HY-B0782

  Acetazolamide		99.89%
  Acetazolamide is a carbonic anhydrase (CA) IX inhibitor with an IC50 of 30 nM for hCA IX. Acetazolamide has diuretic, antihypertensive and anti-gonococcal activities[1][4][5][6].

• HY-N5172

  Actinoidin A	Inhibitor
  Actinoidin A is a glycopeptide antibiotic against Gram-positive bacteria[1].

• HY-B0414R

  Fleroxacin (Standard)	Inhibitor
  Fleroxacin (Standard) is the analytical standard of Fleroxacin. This product is intended for research and analytical applications. Fleroxacin (RO 23-6240) is a broad-spectrum antimicrobial fluoroquinolone.

• HY-170830

  Mtb against-1	Inhibitor
  Mtb against-1 (compound 17af) is an inhibitor of Mycobacterium tuberculosis, with IC90 values of 1.2 μM and 0.9 μM for the wild-type and LepB low-deformation strains, respectively[1].

• HY-116693

  DprE1-IN-12	Inhibitor
  DprE1-IN-12 (compound 377790) is a covalent and DprE1 inhibitors and shows great activity against M. tuberculosis with an IC50 of 0.5 μM[1].

• HY-106594A

  Prussian blue insoluble	Inhibitor
  Prussian blue soluble is a good adsorbent to be used as antidotes for poisoning with cesium or thallium ions. Prussian blue soluble has anticancerous and antibacterial properties. Prussian blue soluble can be used as a contrast agent in photoacoustic and magnetic resonance imaging (MRI)[1][2][3][4].

• HY-P1649B

  SPR741 acetate	Inhibitor	99.55%
  SPR741 acetate (NAB741 acetate) is a cationic peptide derived from polymyxin B and is a potentiator molecule. SPR741 acetate increases the permeability of the outer membrane of Gram-negative bacteria and is used to treat severe Gram-negative bacteria infections. SPR741 acetate inhibits multidrug-resistant Gram-negative bacteria. The spectrum of activity of the antibiotic can be widened when used in combination with SPR741 acetate[1][2].

• HY-W127442R

  Etzadroxil (Standard)
  DPPC (Standard) is the analytical standard of DPPC. This product is intended for research and analytical applications. DPPC (129Y83) is a phosphoglyceride that can be used to prepare lipid monolayers, bilayers, and liposomes. DPPC is the main lipid component of pulmonary surfactant. Dppc-liposome can be effectively used as a delivery vector to induce an immune response against GSL antigen in mice[1][2][3][4][5].

• HY-N10992

  Pomolic acid 3-acetate	Inhibitor
  Pomolic acid 3-acetate is an antitubercular agent with a MIC of 32 μM against Mycobacterium tuberculosis H37Rv[1].

• HY-N2464

  Maltotetraose
  Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α-induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF-induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases[1][2][3][4].

• HY-B0271R

  Pyrazinamide (Standard)	Inhibitor
  Pyrazinamide (Standard) is the analytical standard of Pyrazinamide. This product is intended for research and analytical applications. Pyrazinamide (Pyrazinecarboxamide; Pyrazinoic acid amide) is a potent and orally active antitubercular antibiotic. Pyrazinamide is a proagent that is converted to the active form pyrazinoic acid (POA) by PZase/nicotinamidase encoded by the pncA gene in M. tuberculosis.

• HY-B0213S1

  Sulfameter-13C6	Inhibitor
  Sulfameter-13C6 is the 13C6 labeled Sulfameter. Sulfameter (Sulfametoxydiazine; 5-Methoxysulfadiazine) is an effective long-acting sulfonamide antibiotic with antibacterial activities. Sulfameter can be used for the research of urinary tract infections and lepriasis.

• HY-B0512

  Sulfamerazine	Inhibitor	99.82%
  Sulfamerazine (RP-2632) is a sulfonamide antibacterial.

• HY-145878

  Antibacterial agent 80	Inhibitor
  Antibacterial agent 80 (compound 20) is an antibacterial agent[1].

• HY-B0035S2

  Sulfamethazine-13C6		99.10%
  Sulfamethazine-13C6 is a 13C-labeled n-Acetyl-s-methyl-l-cysteine[1].

• HY-103081

  β-Glucuronidase-IN-1	Inhibitor	99.05%
  β-Glucuronidase-IN-1 is a potent, selective, uncompetitive, and orally active E. coli bacterial β-glucuronidase inhibitor, exhibiting an IC50 and a Ki of 283 nM and 164 nM, respectively[1].

• HY-N9487

  (R)-(-)-α-Phellandrene	Inhibitor
  (R)-(-)-α-Phellandrene ((-)-α-Phellandrene) is an the (R)-(-)-stereoisomer of α-phellandrene. α-phellandrene is an orally active cyclic monoterpene that attenuates inflammatory response, and induces DNA damage[1][2][3].

• HY-113640

  BC-7013	Inhibitor	99.04%
  BC-7013 is a novel semi-synthetic pleuromutilin derivative. BC-7013 has excellent activity against Gram-positive pathogenic bacteria. BC-7013 exhibits potent antibacterial properties against both Staphylococcus, Streptococcus and penicillin-resistant Streptococcus pneumoniae. BC-7013 has activity against Gram-positive pathogenic bacteria, BC-7013 is useful in the research of acute bacterial skin and skin structure infection (ABSSSI)[1].

• HY-18982

  Anisomycin	Inhibitor
  Anisomycin is a potent protein synthesis inhibitor which interferes with protein and DNA synthesis by inhibiting peptidyl transferase or the 80S ribosome system[1]. Anisomycin is a JNK activator, which increases phospho-JNK[2][3]. Anisomycin is a bacterial antibiotic[4].

• HY-N8015S

  Octanal-d16
  Octanal-d16 is the deuterium labeled Octanal[1]. Octanal is an aromatic aldehyde, with antioxidant and antimicrobial activities. Octanal shows cytotoxicity against Hela cells[2].

• HY-N7096R

  Ceftezole (sodium) (Standard)	Inhibitor
  Ceftezole (sodium) (Standard) is the analytical standard of Ceftezole (sodium). This product is intended for research and analytical applications. Ceftezole sodium (CTZ sodium) is a broad-spectrum cephem antibiotic against many species of gram-positive and gram-negative bacteria. Ceftezole sodium (CTZ sodium) is an alpha-glucosidase inhibitor with in vivo anti-diabetic activity[1][2].

• HY-164220

  PPM1A-IN-1	Inhibitor
  PPM1A-IN-1 (Compound IV-4) is an inhibitor for PP2C Ser/Thr phosphatase protein phosphatase Mg2+/Mn2+-dependent 1A. PPM1A-IN-1 exhibits antibacterial activity against Mycobacterium tuberculosis[1].

• HY-W331786R

  Ipconazole (Standard)
  Ipconazole (Standard) is the analytical standard of Ipconazole. This product is intended for research and analytical applications. Ipconazole is a triazole fungicide that can be used for treating rice seed[1].

• HY-16742A

  Gepotidacin (S enantiomer)	Inhibitor	98.27%
  Gepotidacin S enantiomer is an S enantionmer of gepotidacin.

• HY-129292

  Quinocarcin	Inhibitor
  Quinocarcin (DC-52) is a potent antitumor antibiotic. Quinocarcin inhibits Bacillus subtilis DNA, RNA and protein syntheses[1][2].

• HY-B0177S

  Tinidazole-d5	Inhibitor
  Tinidazole-d5 is the deuterium labeled Tinidazole. Tinidazole, an orally available antibacterial agent, is a 5-nitroimidazole with selective activity against anaerobic bacteria and protozoa[1].

• HY-151925

  Antibacterial agent 126	Inhibitor
  Antibacterial agent 126 is a potent antibacterial agent. Antibacterial agent 126 reduces the burden of biofilm to avoid developing agent resistance. Antibacterial agent 126 disturbs the membrane integrity and leads to the leakage of intracellular materials. Antibacterial agent 126 increase in ROS and reactive nitrogen species (RNS) production[1].

• HY-B1436R

  Nifuroxazide (Standard)	Inhibitor
  Nifuroxazide (Standard) is the analytical standard of Nifuroxazide. This product is intended for research and analytical applications. Nifuroxazide is an effective inhibitor of STAT3, also exerts potent anti-tumor and anti-metastasis activity.

• HY-146120

  Antitubercular agent-25	Inhibitor
  Antitubercular agent-25 (Compound 28) is an anti-tubercular agent with an extracellular IC50 of 0.42 μM and an intracellular IC50 of 0.20 μM against M. tuberculosis H37Rv. Antitubercular agent-25 exhibits good metabolic stability[1].

• HY-128447R

  Allyl methyl sulfide (Standard)	Inhibitor

• HY-10394

  Linezolid	Inhibitor
  Linezolid (PNU-100766) is the first member of the class of oxazolidinone synthetic antibiotic. Linezolid acts by inhibiting the initiation of bacterial protein synthesis. Linezolid is used for the treatment of serious infections caused by Gram-positive bacteria that are resistant to several other antibiotics[1][2][3].

• HY-111988

  Penamecillin	Inhibitor
  Penamecillin (Wy 20788) an acetoxymethyl ester of Penicillin G (HY-N7139). Penamecillin is an orally active antibacterial agent[1][2].

• HY-A0166R

  Cilastatin (Standard)	Inhibitor
  Cilastatin (Standard) is the analytical standard of Cilastatin. This product is intended for research and analytical applications. Cilastatin (MK0791) is a reversible, competitive renal dehydropeptidase I inhibitor with an IC50 of 0.1 μM. Cilastatin inhibits the bacterial metallob-lactamase enzyme CphA with an IC50 of 178 μM. Cilastatin is an antibacterial adjunct[1][2][3].

• HY-N10617

  Hygromycin A	Inhibitor
  Hygromycin A is a Borrelia burgdorferi-selective antibiotic. Hygromycin A is a spirochete-specific antibacterial that is conducive to gut health. Hygromycin A can be used for Lyme disease research[1].

• HY-N3287

  Methyl 3-hydroxy-4,5-dimethoxybenzoate
  Methyl 3-hydroxy-4,5-dimethoxybenzoate is a gallic acid derivant isolated from myricaria Laxiflora. Methyl 3-hydroxy-4,5-dimethoxybenzoate shows obvious antimicrobial activities. Methyl 3-hydroxy-4,5-dimethoxybenzoate shows fairly active for oxidation resistance in the presence of H2O2[1].

• HY-B2072AR

  Cephaloridine (hydrate) (Standard)	Inhibitor
  Cefadroxil (hydrate) (Standard) is the analytical standard of Cefadroxil (hydrate). This product is intended for research and analytical applications. Cefadroxil hydrate (BL-S 578 hydrate) is an orally active and first-generation cephalosporin with a broad spectrum antibacterial activity. Cefadroxil hydrate (BL-S 578 hydrate) also acts as a substrate of the peptide transporter PEPT1 and PEPT2[1][2].

• HY-P5673

  Bombinin H1	Inhibitor
  Bombinin H1 is an antimicrobial peptide derived from the skin of moth Bombina variegata. The lethal concentrations of Bombinin H1 against Escherichia coli D21 and Staphylococcus aureus Cowan 1 are 3.8 and 2.1 μM, respectively[1].

• HY-151501

  Antimicrobial agent-11	Inhibitor
  Antimicrobial agent-11 is a SARS-CoV-2 inhibitor with antibacterial activity[1].

• HY-149179

  Polymyxin B	Inhibitor
  Polymyxin B is an antibiotic. Polymyxin B inhibits Gram-negative infections by binding to the LPS of the bacterial wall with high affinity. Polymyxin B neutralizes the effect of endotoxin. Polymyxin B induces bacterial death by increasing its permeability. Polymyxin B is used in endotoxemia research[1][3].

• HY-P5646

  Gageotetrin C	Inhibitor
  Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC value is 0.02-0.04 μM) [1].

• HY-B0519C

  Tylosin lactate	Inhibitor
  Tylosin (lactate) is an anti-bacterial agent that can target spore-forming bacteria. Tylosin (lactate) can increase the levels of Enterococcus and lactobacilli in dogs' feces and help relieve tylosin-responsive diarrhea[1][2].

• HY-W747507

  Reveromycin D
  Reveromycin D is a bacterial metabolite originally isolated from Streptomyces. It inhibits EGF-induced mitogenic activity in Balb/MK cells and has pH-dependent antifungal activity against C. albicans (MICs=2 and >500 μg/mL at pH 3 and 7.4, respectively).2 Reveromycin D also inhibits proliferation of KB and K562 cells (IC50s=1.6 and 1.3 μg/mL, respectively).

• HY-B2053

  Tolclofos-methyl	Inhibitor	98.68%
  Tolclofos-methyl is a broad-spectrum aromatic hydrocarbon fungicide that is used as a see treatment for protection against soil-borne and seed borne fungal pathogens that caused seed decay and seedling blights.

• HY-B0200R

  Cephalexin (Standard)	Inhibitor
  Cephalexin (Standard) is the analytical standard of Cephalexin. This product is intended for research and analytical applications. Cephalexin (Cefalexin) is a potent, orally active semisynthetic cephalosporin antibiotic with a broad antibacterial spectrum. Cephalexin has antibacterial activity against a wide variety of gram-positive and gram-negative bacteria. Cephalexin targets penicillin-binding proteins (PBPs) to inhibit bacterial cell wall assembly. Cephalexin is used for the research of pneumonia, strep throat, and bacterial endocarditis, et al[1][2].

• HY-156859

  NSC309401 dihydrochloride	Inhibitor
  NSC309401 is an inhibitor of E. coli DHFR (IC50: 189 nM, KD: 14.57 nM)[1].

• HY-B0198AR

  Cefaclor (monohydrate) (Standard)	Inhibitor
  Cefaclor (monohydrate) (Standard) is the analytical standard of Cefaclor (monohydrate). This product is intended for research and analytical applications. Cefaclor is a well-absorbed orally active cephalosporin antibiotic. Cefaclor can specifically bind to specific for penicillin-binding protein 3 (PBP3). Cefaclor can be used for the research of depression and kinds of infections caused by bacteria, such as respiratory tract infections, bacterial bronchitis, pharyngitis and skin infections[1][2][3][4].

• HY-123436

  Sarubicin B	Inhibitor
  Sarubicin B is an active product that can be isolated from the culture filtrate of a Streptomyces strain JA 2861. Sarubicin B is a quinone antibiotic that inhibit Gram-positive bacteria and not active against Gram-negative microorganisms[1].

• HY-N6705

  Tropodithietic acid	Inhibitor
  Tropodithietic acid is a sulfur-containing antibiotic produced by the marine bacterium Phaeobacter inhibens. Tropodithietic acid exhibits a strong antibiotic activity against a broad spectrum of bacteria including alpha- and gammaproteobacteria, flavobacteria and actinobacteria[1].

• HY-P10233

  SAAP 148	Inhibitor
  SAAP 148 is an antimicrobial and antibiofilm agent, and exhibits inhibitory efficacy against antibiotic-resistant pathogens, with LC50 of 0.8-12.8 μM[1].

• HY-156289

  Anti-MRSA agent 8	Inhibitor
  Anti-MRSA agent 8 (Compound 7g) is a DAPG derivative with strong antibacterial activity. Anti-MRSA agent 8 assertes its activity by targeting bacterial cell membranes. Anti-MRSA agent 8 can be used for the research of methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-17507B

  Pantoprazole sodium hydrate		99.93%
  Pantoprazole sodium hydrate (BY10232 sodium hydrate) is an orally active and potent proton pump inhibitor (PPI)[1]. Pantoprazole sodium hydrate, a substituted benzimidazole, is a potent H+/K+-ATPase inhibitor with an IC50 of 6.8 μM. Pantoprazole sodium hydrate improves pH stability and has anti-secretory, anti-ulcer activities. Pantoprazole sodium hydrate significantly increased tumor growth delay combined with Doxorubicin (HY-15142)[3][4].

• HY-B0960R

  Sulfabenzamide (Standard)	Inhibitor
  Sulfabenzamide (Standard) is the analytical standard of Sulfabenzamide. This product is intended for research and analytical applications. Sulfabenzamide (N-Sulfanilylbenzamide) is an antimicrobial agent and usually consumed in combination with Sulfathiazole and Sulfacetamide. Sulfabenzamide is effective against Gram-positive and negative bacterial strains[1].

• HY-147237

  LpxC-IN-10	Inhibitor
  LpxC-IN-10 (Compound A) is a high selectivity inhibitor of LpxC. LpxC-IN-10 exhibits MIC values of 0.5 μg/mL against E. coli and K. pneumoniae. LpxC-IN-10 (Compound A) can be used for the research of bacterial infection[1]. LpxC-IN-10 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

• HY-119369

  FadD32 Inhibitor-1	Inhibitor
  FadD32 Inhibitor-1 is a potent FadD32 inhibitor with anti-tubercular activity[1].

• HY-B2223R

  Thiamine nitrate (Standard)
  Thiamine nitrate (Standard) is the analytical standard of Thiamine nitrate. This product is intended for research and analytical applications. Thiamine nitrate is an essential vitamin which can enhance normal neuronal actives.

• HY-B0456R

  Riboflavin (Standard)
  Riboflavin (Standard) is the analytical standard of Riboflavin. This product is intended for research and analytical applications. Riboflavin, an orally active and easily absorbed micronutrient, is a precursor of flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), which serve as coenzymes for numerous enzymatic reactions and perform key metabolic functions by mediating the transfer of electrons in biological oxidation-reduction reaction[1].

• HY-W158160

  AGS1286 sodium	Inhibitor
  AGS1286 (sodium 3-amino-4,6-dimethylthieno[2,3-b]pyridine-2-carboxylate) is an organosulfur compound that serves as a model for investigating the impact of sulfur-containing compounds on enzymatic activities and metabolic pathways. Additionally, it has been employed to explore the regulatory effects of these compounds on bacterial growth and gene expression.

• HY-151166

  β-Glucuronidase-IN-2	Inhibitor
  β-Glucuronidase-IN-2 is a potent E. coli β-glucuronidase inhibitor with an IC50 value of 0.24 μM, an Ki value of 1.09 μM. β-Glucuronidase-IN-2 shows antiproliferative activity. β-Glucuronidase-IN-2 has the potential for the research of anti-cancer and anti-inflammatory therapies[1].

• HY-P1068

  Lysozyme	Inhibitor
  Lysozyme (Muramidase) is a conserved antimicrobial protein. Lysozyme exerts its bactericidal effect by hydrolyzing bacterial cell wall peptidoglycan (PG). Lysozyme plays an important role in limiting bacterial growth on mucosal surfaces and other sites, not only controlling potential pathogens but also limiting overgrowth of microbiota to prevent dysbiosis. Extracellular lysozyme can also degrade polymeric PG into soluble fragments, activate NOD receptors in mucosal epithelial cells, and lead to the secretion of chemokines and activating factors by neutrophils and macrophages[1][2].

• HY-108421

  Xinjiachalcone A	Inhibitor
  Xinjiachalcone A is an active principle of Glycyrrhiza inflata Batalin. Xinjiachalcone A shows both a low MIC and a strong bactericidal activity against H. pylori, with MIC values ranged from 12.5 to 50 µM for seventeen H. pylori strains[1].

• HY-155282

  FASN-IN-6	Inhibitor
  FASN-IN-6 (compound 44) is a potent fatty acid biosynthesis (FAB) inhibitor. FASN-IN-6 is an antibacterial agent with MICs of 1 μg/mL and 4 μg/mL for S. aureus ATCC 25923 and E. faecalis ATCC 29212, respectively[1].

• HY-139774

  Antibacterial agent 57	Inhibitor
  Antibacterial agent 57 (example 25) is a antibacterial agent (extracted from patent WO2013030735A1)[1].

• HY-N6686R

  Virginiamycin M1 (Standard)	Inhibitor
  Virginiamycin M1 (Standard) is the analytical standard of Virginiamycin M1. This product is intended for research and analytical applications. Virginiamycin M1 (Pristinamycin IIA; Ostreogrycin A), produced by Streptomyces virginiae, is an polyunsaturated macrocyclic lactone antibiotic and acts as a component of Virginiamycin (HY-112665)[1]. Virginiamycin M1 alone is against Staphylococcus aureus with a MIC of 0.25 μg/mL.

• HY-15025A

  Sildenafil citrate		99.86%
  Sildenafil citrate is a potent phosphodiesterase type 5 (PDE5) inhibitor with IC50 of 5.22 nM.

• HY-P5838

  Citrullinated LL-37 5cit	Inhibitor
  Citrullinated LL-37 5cit is a citrullinated LL-37 (HY-P1222) peptide. The antiviral and antibacterial effects of Citrullinated LL-37 5cit are significantly reduced compared to native LL-37. Citrullinated LL-37 5cit is unable to reduce LPS-mediated release of TNF-α due to a lack of LPS-binding capacity[1].

• HY-P0311

  LAH4	Inhibitor
  LAH4, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 possesses high plasmid DNA delivery capacities. LAH4 has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes[1][2][3].

• HY-17561

  G-418 disulfate	Inhibitor
  G-418 disulfate (Geneticin sulfate), is an aminoglycoside antibiotic, inhibits protein synthesis in eukaryotes and prokaryotes. G-418 disulfate is commonly used as a selective agent for eukaryotic cells[1].

• HY-10373A

  Trimetrexate trihydrochloride	Inhibitor
  Trimetrexate (CI-898) trihydrochloride is an antibiotic, also a potent and orally active dihydrofolate reductase (DHFR) inhibitor, reducing the production of DNA and RNA precursors and leading to cell death, with IC50 values of 4.74 nM and 1.35 nM for human DHFR and Toxoplasma gondii DHFR. Trimetrexate trihydrochloride can also inhibit the growth of various cancer cells. Trimetrexate trihydrochloride can be used for researching Pneumocystis carinii pneumonia (PCP) and cancer[1][2][3][4][5].

• HY-119604

  Cafamycin	Inhibitor
  Cafamycin is a polyether antibiotic active against gram-positive bacteria, including Staphylococcus aureus. Cafamycin also demonstrates insecticidal and antiprotozoal activities. Cafamycin is isolated from the culture fluid of Streptomyces sp., an organism producing the anthracycline antibiotic galtamycin[1][2].

• HY-B1172R

  Lactulose (Standard)
  Lactulose (Standard) is the analytical standard of Lactulose. This product is intended for research and analytical applications. Lactulose (4-O-β-D-Galactopyranosyl-D-fructose) is a poorly absorbed sugar that can be used to study constipation and hepatic encephalopathy. The drug generally begins to take effect 8 to 12 hours after administration, but it may take two days to improve constipation.

• HY-152035

  Mycobacterial Zmp1-IN-1	Inhibitor
  Mycobacterial Zmp1-IN-1 is a mycobacterial zinc metalloprotease-1 (Zmp1) inhibitor. Mycobacterial Zmp1-IN-1 has anti-mycobacterial activity for Mtb H37Ra in dose-dependent inhibition. Mycobacterial Zmp1-IN-1 can be used for the research of tuberculosis (TB)[1].

• HY-W007355S1

  Skatole-d8	Inhibitor	98.50%
  Skatole-d8 is the deuterium labeled Skatole. Skatole is produced by intestinal bacteria, regulates intestinal epithelial cellular functions through activating aryl hydrocarbon receptors and p38[1].

• HY-116926

  Deoxynybomycin	Inhibitor
  Deoxynybomycin is an antibiotic, that can be isolated from Streptomyces, and antibacterial activity against Staphylococcus aureus. Deoxynybomycin is the inhibitor for DNA gyrase and Topoisomerase I. Deoxynybomycin induces expression of p21/WAF1, exhibits cytotoxicity and induces apoptosis in cancer cells Saos-2, TMK-1, and THP-1[1][2].

• HY-123026

  Salannin	Inhibitor	99.30%
  Salannin, a limonoid bitter principle of the seed oil of Azadirachta indica, shows antiulcer and spermicidal activities. Salannin displays antibacterial activity towards both Gram-positive and Gram-negative bacteria[1][2].

• HY-W145053

  ChloraMine-T hydrate	Inhibitor
  ChloraMine-T hydrate (Sodium chloro(4-methylbenzenesulfonyl)azanide (hydrate)) is a common reagent in various synthetic processes. It has been used as a reagent in aminohydroxylation and allylic amination reactions, a nitrogen source in aziridination reactions of alkenes and alkenes, and deprotection of sulfur groups in sulfur-containing compounds. It has been used as a reagent in the synthesis of factor Xa inhibitors. ChloraMine-T hydrate (Sodium chloro(4-methylbenzenesulfonyl)azanide (hydrate)) (0.2% w/v) is also an antimicrobial agent that kills Staphylococcus epidermidis, Staphylococcus aureus, Enterococcus faecalis, Escherichia coli, Proteus mirabilis, and Enterococcus cloacae.

• HY-14926B

  Levonadifloxacin arginine	Inhibitor
  Levonadifloxacin ((S)-(-)-Nadifloxacin; WCK 771) arginine is a broad-spectrum antistaphylococcal agent. Levonadifloxacin arginine has antimicrobial activity against methicillin-sensitive Staphylococcus aureus (MSSA) and methicillin-resistant Staphylococcus aureus and reduces phagocytosis of MRSA and MSSA strains by monocytic THP-1 cells[1].

• HY-B0449

  Methacycline hydrochloride	Inhibitor	99.71%
  Methacycline hydrochloride is a tetracycline antibiotic and can inhibits bacterial protein synthesis. Methacycline hydrochloride is a potent epithelial-mesenchymal transition (EMT) inhibitor. Methacycline hydrochloride blocks EMT in vitro and fibrogenesis in vivo without directly affecting TGF-β1 Smad signaling. Methacycline hydrochloride is an antimicrobial and has the potential for pulmonary fibrosis[1].

• HY-N10272

  Avenaciolide	Inhibitor
  Avenaciolide is an antifungal bis-γ-lactone found in Aspergillus avenaceus. Avenaciolide has also antibacterial action. Avenaciolide is a specific inhibitor of glutamate transport in rat liver mitochondria. Avenaciolide interferes with the ability of ADP to stimulate the rate of glutamate oxidation[1][2].

• HY-N4181

  Kanzonol C	Inhibitor
  Kanzonol C, a flavonoid isolated from the twigs of Dorstenia barteri (Moraceae), has potential to treat bacterial and fungal infections[1].

• HY-B1460R

  Sulconazole (mononitrate) (Standard)	Inhibitor
  Sulconazole (mononitrate) (Standard) is the analytical standard of Sulconazole (mononitrate). This product is intended for research and analytical applications. Sulconazole mononitrate ((±)-Sulconazole mononitrate), an imidazole derivative, is a broad-spectrum fungicide. Sulconazole mononitrate can be used for the research of dermatomycoses, pityriasis versicolor, and cutaneous candidiasis[1][2].

• HY-111903

  Levomecol
  Levomecol (Chloramphenicol), made up of Chloramphenicol, Methyluracil, is a broad-spectrum antibiotic that is derived from the bacterium Streptomyces venezuelae. Levomecol (Chloramphenicol)) stops bacterial growth by binding to the bacterial ribosome (blocking peptidyl transferase) and inhibiting protein synthesis[1][2][3].

• HY-A0071R

  Tildipirosin (Standard)	Inhibitor
  Tildipirosin (Standard) is the analytical standard of Tildipirosin. This product is intended for research and analytical applications. Tildipirosin, a long-acting macrolide, has antibiotic activity.

• HY-B1825R

  Cefoxitin (Standard)	Inhibitor
  Cefoxitin (Standard) is the analytical standard of Cefoxitin. This product is intended for research and analytical applications. Cefoxitin, a β-lactam antibiotic, is a broad-spectrum, second-generation cephalosporin. Cefoxitin has a broad spectrum antibacterial activity which includes anaerobic as well as Gram-positive and Gram-negative aerobic bacteria[1][2].

• HY-151548

  Mtb-cyt-bd oxidase-IN-1	Inhibitor
  Mtb-cyt-bd oxidase-IN-1 (compound 1x) is a Mycobacterium tuberculosis cytochrome bd oxidase (Mtb cyt-bd oxidase) inhibitor with an IC50 value of 0.13 μM. Mtb-cyt-bd oxidase-IN-1 can be used in tuberculosis research[1].

• HY-117660S

  Lincomycin-d3		99.90%
  Lincomycin-d3 is the deuterium labeled Lincomycin[1].

• HY-B1530

  Ammonium lactate (60% in water)	Inhibitor
  Ammonium lactate is the ammonium salt of lactic acid, with mild anti-bacterial properties. Ammonium lactate can be used for the research of xerosis[1][2][3].

• HY-A0122

  Plicamycin	Inhibitor
  Plicamycin (Mithramycin A) is a selective specificity protein 1 (Sp1) inhibitor. Plicamycin inhibits the growth of various cancers by decreasing Sp1 protein. Plicamycin inhibits GSTM2 promoter activity and protein expression[1][2].

• HY-W392548

  1-O-(4-Hydroxybenzoyl)-glycerol	Inhibitor
  1-O-4-Hydroxybenzoyl-glycerol is an antimicrobial agent against Staphylococcus aureus, Escherichia coli, Saccharomyces cerevisiae, and Fusarium culmorum (20 mM, maximum inhibition rate: 70%). 1-O-(4-Hydroxybenzoyl)-glycerol stimulates low skin irritation[1].

• HY-108279

  Ulifloxacin	Inhibitor	98.16%
  Ulifloxacin is a broad-spectrum quinolone antibiotic. Ulifloxacin is the active metabolite of Prulifloxacin (HY-B0024). Ulifloxacin has anti-bacterial activity[1].

• HY-W039169

  4-Chloroguaiacol	Inhibitor	99.89%
  4-Chloroguaiaco (4-Chloro-2-methoxyphenol) is a phenol derivative, with antimicrobial activity. 4-Chloroguaiaco shows inhibition against S. aureus and E. coli with MICs of both 110 μg/mL[1].

• HY-B1729S1

  Phenoxyethanol-d4	Inhibitor
  Phenoxyethanol-d4 is the deuterium labeled Phenoxyethanol[1]. Phenoxyethanol has a broad spectrum of antimicrobial activity against various gram-negative and gram-positive bacteria. Phenoxyethanol is an uncouple agent in oxidative phosphorylation from respiration and competitively inhibits malate dehydrogenase. Phenoxyethanol is used as a preservative in cosmetic, vaccine, and textile, et al[2].

• HY-Y1093R

  Ethyl acetoacetate (Standard)
  Ethyl acetoacetate (Standard) is the analytical standard of Ethyl acetoacetate. This product is intended for research and analytical applications. Ethyl acetoacetate (Ethyl acetylacetate) is an ester widely used as an intermediate in the synthesis of many varieties of compounds[1][2][3]. Ethyl acetoacetate is an inhibitor of bacterial biofilm[4].

• HY-162926

  Antituberculosis agent-12	Inhibitor
  Antituberculosis agent-12 (compound 3408) is a narrow-spectrum antituberculosis prodrug phosphate that has the ability to inhibit drug-resistant tuberculosis infection[1].

• HY-W013699R

  Chlorhexidine (diacetate) (Standard)	Inhibitor
  Chlorhexidine (diacetate) (Standard) is the analytical standard of Chlorhexidine (diacetate). This product is intended for research and analytical applications. Chlorhexidine diacetate is a biguanide disinfectant with rapid bactericidal activity against both Gram-positive and Gram-negative organism. The antibacterial effect of chlorhexidine diacetate is related to its action on the bacterial cell membrane and to precipitation of intracellular contents[1].

• HY-P5722

  Peptide 5f	Inhibitor
  Peptide 5f is an antimicrobial peptide derived from wasp venom. Peptide 5f has antimicrobial activity against bacteria and fungi. Peptide 5f has little hemolytic activity on human red blood cells [1].

• HY-12904

  TCA1	Inhibitor	98.29%
  TCA1 is a small molecule with activity against agent-susceptible and -resistant Mycobacterium tuberculosis (Mtb). TCA1 inhibits enzymes involved in cell wall and molybdenum cofactor biosynthesis, such as DprE1 and MoeW[1].

• HY-143415

  Metallo-β-lactamase-IN-7	Inhibitor
  Metallo-β-lactamase-IN-7 is a potent VIM-Type metallo-β-lactamase inhibitor with IC50s of 0.019 μM, 13.64 μM, 0.38 μM for VIM-2, VIM-1 and VIM-5. Metallo-β-lactamase-IN-7 potentiate antibacterial activity of Meropenem against the Gram-negative bacterial strains[1].

• HY-B0466

  Cloxacillin sodium monohydrate	Inhibitor	99.37%
  Cloxacillin sodium monohydrate is an orally active antibacterial agent and β-lactamase inhibitor with an IC50 of 0.04 μM. Cloxacillin sodium monohydrate can suppress the S. aureus-induced inflammatory response by inhibiting the activation of MAPKs, NF-кB and NLRP3-related proteins[1][2][3].

• HY-12480

  Lanopepden	Inhibitor	98.62%
  Lanopepden (GSK 1322322) is a peptidyl peptidase (PDF) inhibitor. Lanopepden inhibits PDF activity, preventing bacterial protein synthesis, thereby exerting antibacterial activity. Lanopepden is primarily effective against Gram-positive bacteria. Lanopepden is used in the study of acute bacterial skin and skin structure infections[1].

• HY-B0546A

  Procaine hydrochloride		99.90%
  Procaine hydrochloride is a DNA-demethylating agent. Procaine hydrochloride acts through multiple targets and has a slow onset and a short duration of action[1][2].

• HY-B0274AR

  Chlorprothixene hydrochloride (Standard)	Inhibitor
  Chlorprothixene (hydrochloride) (Standard) is the analytical standard of Chlorprothixene (hydrochloride). This product is intended for research and analytical applications. Chlorprothixene hydrochloride is a dopamine and histamine receptors antagonist with Kis of 18 nM, 2.96 nM, 4.56 nM, 9 nM and 3.75 nM for hD1, hD2, hD3, hD5 and hH1 receptors, respectively. Antipsychotic activity[1].

• HY-116282M

  Dextran sulfate, low sulfate (MW 40000)
  Dextran sulfate, low sulfate (MW 40000), a biopolymer, is a sulfated polysaccharide. Dextran sulfate, low sulfate (MW 40000) has antiviral, antibacterial, anti-inflammatory, antifibrotic, and wound-healing properties. Dextran sulfate can be used as an additive in cell culture media for preventing cell aggregation and in cosmetics as a gel-forming agent[1].

• HY-N7454

  Anhydroerythromycin A	Inhibitor
  Anhydroerythromycin A is a degradation product of the macrolide antibiotic erythromycin. Anhydroerythromycin A is formed via degradation of erythromycin in acidic aqueous solutions in vitro as well as in vivo. Anhydroerythromycin A is active against S. aureus and B. cereus in vitro (MICs = 12.5 and 6.25 μg/ml, respectively). Anhydroerythromycin A also inhibits steroid 6β-hydroxylase activity associated with the cytochrome P450 (CYP) isoform CYP3A in human liver microsomes.

• HY-B0395

  Sitafloxacin	Inhibitor	99.37%
  Sitafloxacin (DU6859a) is a potent, orally active fluoroquinolone antibiotic. Sitafloxacin shows antichlamydial activity and antibacterial activities against a broad range of gram-positive and gram-negative bacteria, including anaerobic bacteria, as well as against atypical pathogens. Sitafloxacin can be used for the research of respiratory tract infection and urinary tract infection[1][2].

• HY-A0251S

  Cefpodoxime-d3
  Cefpodoxime-d3 is the deuterium labeled Cefpodoxime[1].

• HY-N6769

  Radicicol	Inhibitor
  Radicicol is an inhibitor of Hsp90 with an IC50 value < 1 μM, and leads to proteasomal degradation[1]. Radicicol exhibits inhibition on PDK with IC50s of 230 μM (PDK1) and 400 μM (PDK3). Radicicol is an antifungal and antimalarial antibiotic, impairs mitochondrial replication by targeting P. falciparum topoisomerase VIB[2]. Radicicol is also an inhibitor of fat mass and obesity-associated protein (FTO), with an IC50 value of 16.04 μM[3].

• HY-124781R

  ML406 (Standard)	Inhibitor

• HY-120859

  Zidebactam	Inhibitor
  Zidebactam (WCK-5107) is a potent β-lactamase inhibitor[1]. Zidebactam also is a penicillin-binding protein2 (PBP2) inhibitor with an IC50 of 0.26 μg/mL[2].

• HY-170802

  Anti-MRSA agent 22	Inhibitor
  Anti-MRSA agent 22 (Compound 5a) is a potent antibacterial agent against MRSA with a MIC value of 6 µg/mL. Anti-MRSA agent 22 exhibits high binding affinity (−11.19) to FabI[1].

• HY-15306AR

  Eltrombopag (Olamine) (Standard)	Inhibitor
  Eltrombopag (Olamine) (Standard) is the analytical standard of Eltrombopag (Olamine). This product is intended for research and analytical applications. Eltrombopag Olamine (Eltrombopag diethanolamine salt) is an orally active thrombopoietin receptor nonpeptide agonist. Eltrombopag Olamine owns thrombopoietic activity, and has been used to research low blood platelet counts with chronic immune thrombocytopenia. Eltrombopag Olamine can be used for the research of cardiovascular. Eltrombopag Olamine also has highly inhibitory effects against multidrug resistant Staphylococcus aureus. Eltrombopag Olamine can induce apoptosis in hepatocellular carcinomab (HCC) as well[1][2][3][4][5].

• HY-N0231R

  Bavachalcone (Standard)	Inhibitor
  Bavachalcone (Standard) is the analytical standard of Bavachalcone. This product is intended for research and analytical applications. Bavachalcone is a potent inducer of apoptosis. Bavachalcone exerts anticancer activity by promoting autophagy and apoptosis in HepG2 cells. Bavachalcone acts as an anti-neuroinflammatory and antidepressant through the NF-κB pathway. Bavachalcone inhibits osteoclasts by interfering with ERK and Akt signaling pathways and the expression of c-Fos and NFATc1. Bavachalcone exhibits a significant inhibitory effect on baculovirus-expressed BACE-1 in vitro[1][2][3][4].

• HY-151102

  Fabimycin	Inhibitor
  Fabimycin is a FabI inhibitor with potent antibacterial activity against gram-negative bacteria. Fabimycin is effective against drug-resistant gram-negative Infections in vivo[1].

• HY-B0398S

  Nalidixic Acid-d5	Inhibitor
  Nalidixic Acid-d5 is the deuterium labeled Nalidixic acid. Nalidixic acid, a quinolone antibiotic, is effective against both gram-positive and gram-negative bacteria. Nalidixic acid acts in a bacteriostatic manner in lower concentrations and is bactericidal in higher concentrations. Nalidixic acid inhibits a subunit of DNA gyrase and topoisomerase IV and reversibly blocks DNA replication in susceptible bacteria[1].

• HY-W753904

  Pradofloxacin	Inhibitor	98.02%
  Pradofloxacin, a third-generation fluoroquinolone antibacterial agent[1]

• HY-B1127

  Betamipron	Inhibitor	99.45%
  Betamipron is a chemical compound which is used together with Panipenem to inhibit Panipenem uptake into the renal tubule and prevent nephrotoxicity.

• HY-123156

  SC-23110	Inhibitor
  SC-23110 is a potent anti-acne agent. SC-23110 inhibits the growth of P. acnes, one of the organisms associated with acne, and most frequently mentioned as the organism involved in the pathogenesis of inflammatory pustules/lesions[1].

• HY-W354851

  Pisiferic acid	Inhibitor
  Pisiferic acid is an antibacterial agent with inhibitory activity against Gram-negative/positive bacteria such as P. vulgaris, S. aureus and B. subtilis. Pisiferic acid can be used to study bacterial infections[1].

• HY-B0330A

  Levofloxacin hydrate	Inhibitor	99.93%
  Levofloxacin hydrate (Levofloxacin hemihydrate) is an orally active antibiotic and is active against both Gram-positive and Gram-negative bacteria. Levofloxacin hydrate inhibits the DNA gyrase and topoisomerase IV. Levofloxacin hydrate can be used for chronic periodontitis, airway inflammation and BK Viremia research. Levofloxacin hydrate shows anti-orthopoxvirus activity[1][2][3][4].

• HY-P1674

  Murepavadin	Inhibitor
  Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance[1][2].

• HY-103399R

  Trovafloxacin (mesylate) (Standard)	Inhibitor
  Clarithromycin (Standard) is the analytical standard of Clarithromycin. This product is intended for research and analytical applications. Clarithromycin has a broad spectrum of antimicrobial activity. Clarithromycin inhibits the CYP3A4-catalyzed triazolam alpha-hydroxylation with the IC50 (Ki) value of 56 (43) μM[2]. Clarithromycin significantly inhibits the HERG potassium current[3].Clarithromycin affects the autophagic flux by impairing the signaling pathway linking hERG1 and PI3K[4].

• HY-163716

  Antibacterial agent 222	Inhibitor
  Antibacterial agent 222 ((R)-O30 (5)) is a antimicrobial agent that inhibits methicillin-resistant Staphylococcus aureus (MRSA)[1].

• HY-163486

  Antituberculosis agent-10	Inhibitor
  Antituberculosis agent-10 (Compound 9) has excellent antibacterial activity against Mycobacterium tuberculosis (MIC = 0.3 μM). Antituberculosis agent-10 inhibits protein synthesis by targeting the 50S ribosomal subunit of the bacterium, thus exerting its antibacterial effect. Antituberculosis agent-10 is orally active[1].

• HY-117250

  EcDsbB-IN-10	Inhibitor	98.71%
  EcDsbB-IN-10 (compound 12) is an inhibitor of EcDsbB (E. coli DsbB) enzyme, with a Ki of 0.8 nM and an IC50 of 18.85 nM[1].

• HY-161756

  DNA Gyrase-IN-10	Inhibitor
  DNA Gyrase-IN-10 is a potent DNA gyrase inhibitor with potent antibacterial effects. DNA Gyrase-IN-10 has inhibitory effects on both Gram-positive and Gram-negative bacteria[1].

• HY-13588A

  Cefsulodin	Inhibitor
  Cefsulodin (SCE-129) showed potent activity against Pseudomonas aeruginosa and strains susceptible to penicillin and gentamicin, with effectiveness comparable to that of gentamicin and debendazole. However, its effectiveness was diminished against penicillin-resistant strains of P. aeruginosa, particularly strains that were also resistant to gentamicin. For P. aeruginosa maltofila, SCE-129 showed similar minimum inhibitory concentrations to penicillin, gentamicin, and debendazole. Pseudomonas cepacia strains generally showed moderate resistance to SCE-129 and penicillin, and high resistance to gentamicin and debendazole[1].

• HY-B0512S

  Sulfamerazine D4	Inhibitor	99.00%
  Sulfamerazine-d4 is a deuterium labeled Sulfamerazine. Sulfamerazine, a sulfonamide antibacterial, inhibits bacterial synthesis of dihydrofolic acid by competing with para-aminobenzoic acid (PABA) for binding to dihydropteroate synthesizes[1].

• HY-B1828AR

  Spectinomycin (dihydrochloride pentahydrate) (Standard)	Inhibitor
  Spectinomycin (dihydrochloride pentahydrate) (Standard) is the analytical standard of Spectinomycin (dihydrochloride pentahydrate). This product is intended for research and analytical applications. Spectinomycin dihydrochloride pentahydrate is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin dihydrochloride pentahydrate acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin dihydrochloride pentahydrate is also a noncompetitive inhibitor of td intron RNA with an Ki value of 7.2 mM[1]-[5].

• HY-D0215

  Safranin	Inhibitor
  Safranin (Safranin T) is an important and classical phenazinium dye. Safranin has been extensively used in the academic field as a spectroscopic probe and indicator. Safranin possesses a planar structure and cationic charge. Safranin can readily intercalate into biological macromolecules, including DNA and proteins. Safranin has antibacterial effects against gram-positive bacteria (S. aureus). Safranin can be used as a redox indicator in the determination of metal ion concentration[1][2][3][4].

• HY-N12261

  Benastatin B	Inhibitor
  Benastatin B is an inhibitor for glutathione S-transferase, that inhibits human pi class GST with an IC50 of 1.10 μg/mL. Benastatin B exhibits board-spectrum antibacterial efficacy, inhibits MRSA with MIC 3.1 μg/mL. Benastatin B exhibits anti-inflammatory efficacy through inhibition of IgE mediated β-hexosaminidase release with an IC50 of 79 μg/mL[1][2].

• HY-153429

  WU-FA-01	Inhibitor
  WU-FA-01, a hydrogenated derivative of WU-FA-00, is an antibacterial agent that exhibits high levels of antibacterial activity against Gram-positive strains and also has some anti-inflammatory activity[1].

• HY-123922

  NOSO-502	Inhibitor
  NOSO-502 is an inhibitor of bacterial translation. NOSO-502 exhibits inhibitory activity against Enterobacteriaceae. NOSO-502 has good safety and antibacterial properties[1].

• HY-B1275R

  Cephalothin (sodium) (Standard)	Inhibitor
  Cephalothin (sodium) (Standard) is the analytical standard of Cephalothin (sodium). This product is intended for research and analytical applications. Cephalothin sodium is a first-generation cephalosporin antibiotic with broad antibacterial activity and is effective against Gram-positive and Gram-negative bacteria.

• HY-B1389

  Lactitol monohydrate
  Lactitol monohydrate is a disaccharide analogue of lactulose.

• HY-137898

  Avilamycin A
  Avilamycin A is an oral active antibiotic. Avilamycin A is active against veterinary isolates of C. perfringens (MICs ≤ 0.06-0.5 mg/L) and B. hyodysenteriae (MICs = 12.5-100 μg/ml)[1].

• HY-118946

  BPH-1358	Inhibitor	99.12%
  BPH-1358 (NSC50460) is a potent human farnesyl diphosphate synthase (FPPS) and undecaprenyl diphosphate synthase (UPPS) inhibitor with IC50s of 1.8 μM and 110 nM, respectively, and is active against S. aureus in vitro (MIC ~250 ng/mL)[1][2].

• HY-101413

  Iberin	Inhibitor
  Iberin (NSC 321801), a sulfoxide analogue of sulforaphane, is a naturally occurring member of isothiocyanate family. Iberin inhibits cell survival with an IC50 of 2.3 μM in HL60 cell. Iberin induces apoptosis.

• HY-N3612

  Communic acid
  Communic acid ((+)-Communic acid) is a natural compound isolated from the branches of Platycladus orientalis. Communic acid displays minimum inhibitory concentration of 31 μM and IC50 of 15 μM against M. tuberculosis H37Ra.Communic acid exhibits protective effects against UVB-induced skin aging[1][2][3].

• HY-161860

  Antibacterial agent 233	Inhibitor
  Antibacterial agent 233 (Compound 7c) exhibits inhibitory efficacy against Helicobacter pylori with MIC of 0.4-1.6 μg/mL. Antibacterial agent 233 inhibits jack bean urease (IC50 is 0.27 μg/mL), changes the permeability of H. pylori cell membrane, causes the leakage of cellular contents. Antibacterial agent 233 exhibits metabolic stability in whole blood and artificial gastric fluid. Antibacterial agent 233 exhibits antitumor efficacy against U2OS in mice[1].

• HY-B2237

  Lysozyme from chicken egg white	Inhibitor
  Lysozyme from chicken egg white is a bactericidal enzyme, and it lyses gram-positive bacteria. Lysozyme from chicken egg white can also be used for the research of HIV infection and pulmonary emphysema[1][2][3].

• HY-147882

  Anti-MRSA agent 6	Inhibitor
  Anti-MRSA agent 6 (compound 3q6) is a potent anti-methicillin-resistant Staphylococcus aureus (anti-MRSA) agent. Anti-MRSA agent 6 shows low cytoxicity for MCF-7, A549 cells[1].

• HY-B2184R

  Sofalcone (Standard)	Inhibitor
  Sofalcone (Standard) is the analytical standard of Sofalcone. This product is intended for research and analytical applications. Sofalcone, a gastric antiulcer agent, is known to induce the expression of Heme oxygenase-1 (HO-1) in gastric epithelium.

• HY-P10556

  (KFF)3K	Inhibitor
  (KFF)3K is a cell penetrating peptide that can promote the absorption of other antibiotics by disrupting the outer membrane of bacteria. (KFF)3K can be introduced into a hydrocarbon scaffold to induce its antibacterial properties, making it an effective antimicrobial peptide. (KFF)3K can be used in the development of new antimicrobial agents[1].

• HY-128467

  Dehydroacetic acid sodium	Inhibitor	99.87%
  Dehydroacetic acid sodium, a pyrone derivative acts as an antibacterial and antifungal agent. Dehydroacetic acid possess phytotoxic activity[1].

• HY-B0972R

  Cinchophen (Standard)	Inhibitor
  Cinchophen (Standard) is the analytical standard of Cinchophen. This product is intended for research and analytical applications. Cinchophen is a potent and orally active non-steroidal anti-inflammatory agent, has analgesic and antimicrobial effects. Cinchophen can be used for the research of arthritis and some liver diseases[1].

• HY-P99770

  Omodenbamab	Inhibitor
  Omodenbamab is an anti-SpA (Staphylococcal protein A) human monoclonal antibody with a KD value of 0.0467 nM. Omodenbamab circumvents a key S. aureus evasion mechanism by targeting the cell wall moiety Protein A (SpA). Omodenbamab can be used in research of S. aureus bloodstream infection[1].

• HY-129629

  Thiomandelic acid	Inhibitor
  Thiomandelic acid is a broad spectrum inhibitor of Zinc -lactamases[1].

• HY-W747491

  Triclosan-13C12	Inhibitor
  Triclosan-13C12 is 13C labeled Triclosan. Triclosan is a broad-spectrum antibacterial agent that inhibits bacterial fatty acid synthesis at the enoyl-acyl carrier protein reductase (FabI) step. Triclosan inhibits E. coli enoyl-acyl carrier protein reductase (FabI) and FabI containing a glycine-to-valine substitution at position 93 (FabIG93V) with IC50s of 2 μM and 10 μM, respectively. Triclosan causes apoptotic effect in cultured rat neural stem cells (NSC). Triclosan exacerbates colitis and colitis-associated colorectal tumorigenesis in animal models[1][2][3][4].

• HY-119631

  Nornidulin	Inhibitor
  Nornidulin is a depsidone originally isolated from A. nidulans that has antibacterial activity against M. tuberculosis and M. ranoe as well as antifungal activity against T. tonsurans and M. audouini. It also inhibits the growth of methicillin-resistant S. aureus (MRSA; MIC=2 μg/mL).2 Nornidulin has cytotoxic activity in MOLT-3 cells (IC50=35.7 μM) but not HuCCA-1, HepG2, or A549 cells (IC50s=>116.4 μM).

• HY-N2564

  Isomagnolol	Inhibitor
  Isomagnolol is a lignan with antimicrobial activity. Isomagnolol can be isolated from the root of tea plant[1].

• HY-161922

  Antibacterial agent 235	Inhibitor
  Antibacterial agent 235 (compound thy2I) shows antibacterial activity with minimum inhibitory concentration (MIC) values ranging from 0.5 μg/mL to 8 μg/mL. Antibacterial agent 235 could kill both gram-positive and gram-negative bacteria via a membrane-targeting mechanism of action with a low frequency of resistance[1].

• HY-10581

  Gatifloxacin	Inhibitor	99.69%
  Gatifloxacin (AM-1155; BMS-206584; PD135432) is a potent fluoroquinolone antibiotic with broad-spectrum antibacterial activity. Gatifloxacin inhibits bacterial type II topoisomerases (IC50=13.8 μg/ml for S. aureus topoisomerase IV) and E. coli DNA gyrase (IC50=0.109 μg/ml)[1]. Gatifloxacin can be used to treat bacterial conjunctivitis?in vivo.

• HY-N2011R

  Octyl gallate (Standard)	Inhibitor
  Octyl gallate (Standard) is the analytical standard of Octyl gallate. This product is intended for research and analytical applications. Octyl gallate (Progallin O) is widely used as a food additive, with antimicrobial and antioxidant activity[1][2]. Octyl gallate (Progallin O) shows selective and sensitive fluorescent property[2]. Octyl gallate shows a marked antiviral effect against HSV-1, vesicular stomatitis virus (VSV) and poliovirus[3].

• HY-N8339

  Decatromicin B