1. Membrane Transporter/Ion Channel
  2. Chloride Channel

Chloride Channel

Chloride channels represent a relatively under-explored target class for drug discovery as elucidation of their identity and physiological roles has lagged behind that of many other drug targets. Chloride channels are involved in a wide range of biological functions, including epithelial fluid secretion, cell-volume regulation, neuroexcitation, smooth-muscle contraction and acidification of intracellular organelles. Mutations in several chloride channels cause human diseases, including cystic fibrosis, macular degeneration, myotonia, kidney stones, renal salt wasting and hyperekplexia. Chloride-channel modulators have potential applications in the treatment of some of these disorders, as well as in secretory diarrhoeas, polycystic kidney disease, osteoporosis and hypertension.

Chloride channel accessory proteins, also known as calcium-activated chloride channel regulators (CLCA proteins), are a family of transmembrane proteins that have been suggested to have a role in chloride conductance in epithelial cells.

Chloride Channel Related Products (13):

Cat. No. Product Name Effect Purity
  • HY-N0822
    Shikonin Inhibitor 99.64%
    Shikonin is a major component of a Chinese herbal medicine named zicao. Shikonin has shown various biological activities, including inhibition of TNF-α, NF-κB, HIV-1.
  • HY-12693
    R(+)-IAA-94 Inhibitor 98.37%
    R((addition))-IAA-94 is a potent indanyloxyacetic acid blocker of epithelial chloride channels.
  • HY-B1221
    Flufenamic acid Inhibitor 99.92%
    Flufenamic acid is a non-steroidal anti-inflammatory agent, inhibits cyclooxygenase (COX), activates AMPK, and also modulates ion channels, blocking chloride channels and L-type Ca2+ channels, modulating non-selective cation channels (NSC), activating K+ channels.
  • HY-100611
    CaCCinh-A01 Inhibitor 99.60%
    CaCCinh-A01 is an inhibitor of both TMEM16A and calcium-activated chloride channel (CaCC) with IC50s of 2.1 and 10 μM, respectively.
  • HY-101012
    NPPB Inhibitor 99.89%
    NPPB is a blocker of the outwardly rectifying chloride channel (ORCC).
  • HY-108690
    Fluxametamide Antagonist
    Fluxametamide is an insecticide with wide spectrum, acts as an antagonist of GABA- and glutamate-gated chloride channels, with IC50 of 1.95  nM and 225  nM for M. domestica GABACls and GluCls.
  • HY-B0679
    Lubiprostone Activator >98.0%
    Lubiprostone(SPI-0211;RU0211) is a gastrointestinal agent used for the treatment of idiopathic chronic constipation.
  • HY-B0493
    Niflumic acid Inhibitor 99.86%
    Niflumic acid, a Ca2+-activated Cl- channel blocker, is an analgesic and anti-inflammatory agent used in the treatment of rheumatoid arthritis.
  • HY-18996
    Adjudin Inhibitor >98.0%
    Adjudin is an extensively studied male contraceptive with a superior mitochondria-inhibitory effect. Adjudin is also a potent Cl- channel blocker.
  • HY-P0173A
    Chlorotoxin Inhibitor >98.0%
    Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker. Sequence: Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35);MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35).
  • HY-100244
    NS1652 Inhibitor
    NS1652 is a reversible anion conductance inhibitor, blocks chloride channel, with an IC50 of 1.6 μM in human and mouse red blood cells.
  • HY-100322
    H100 Inhibitor
    H100 is a Cl- transport inhibitor, with partial effects against both the NaK2Cl cotransporter and the Band 3 anion exchanger, but no effect against KCl cotransporter, in human erythrocytes.
  • HY-B0908
    Meticrane Inhibitor 98.79%
    Meticrane is a diuretic. Meticrane inhibits the reabsorption of sodium and chloride ions in the distal convoluted tubule. Meticrane is used to treat essential hypertension.