1. GPCR/G Protein
  2. Neuropeptide Y Receptor

Neuropeptide Y Receptor

Neuropeptide Y receptors are a class of G-protein coupled receptors which are activated by the closely related peptide hormones neuropeptide Y, peptide YY and pancreatic polypeptide. These receptors are involved in the control of a diverse set of behavioral processes including appetite, circadian rhythm, and anxiety.

Neuropeptide Y (NPY) is a potent orexigenic neuropeptide, and antagonism of NPY Y1 and NPY Y5 receptors (NPYxR) is considered a potentially important anti-obesity drug target.

Neuropeptide Y (NPY) is widely distributed in the human body and contributes to a vast number of physiological processes. A number of other uses for modulators of NPY receptors have been implied in a range of diseases.

Neuropeptide Y Receptor Related Products (21):

Cat. No. Product Name Effect Purity
  • HY-14423
    Velneperit Antagonist 99.26%
    Velneperit (S-2367) is a novel neuropeptide Y (NPY) Y5 receptor antagonist.
  • HY-15411
    MK-0557 Antagonist 98.28%
    MK-0557 is a highly selective, orally available neuropeptide Y5 receptor antagonist with a Ki of 1.6 nM.
  • HY-100717
    HT-2157 Antagonist >98.0%
    HT-2157 (SNAP 37889) is a selective, high-affinity, competitive antagonists of galanin-3 receptor (Gal3).
  • HY-P1578A
    Galanin (1-16), mouse, porcine, rat TFA Agonist 98.08%
    Galanin (1-16), mouse, porcine, rat (TFA) is an agonist of the hippocampal galanin receptor, with a Kd of 3 nM. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile;GWTLNSAGYLLGPHAI.
  • HY-P1578
    Galanin (1-16), mouse, porcine, rat Agonist
    Galanin (1-16), mouse, porcine, rat is an agonist of the hippocampal galanin receptor, with a Kd of 3 nM. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile;GWTLNSAGYLLGPHAI.
  • HY-107723
    CGP71683 hydrochloride Antagonist 99.63%
    CGP71683 hydrochloride is a competitive neuropeptide Y5 receptor antagonist with a Ki of 1.3 nM, and shows no obvious activity at Y1 receptor (Ki, >4000 nM) and Y2 receptor (Ki, 200 nM) in cell membranes.
  • HY-P0198A
    Neuropeptide Y (29-64), amide, human TFA
    Neuropeptide Y (29-64), amide, human (TFA) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
  • HY-101986
    BIIE-0246 Antagonist >99.0%
    BIIE-0246 is a potent and highly selective non-peptide neuropeptide Y (NPY) Y2 receptor antagonist, with an IC50 of 15 nM.
  • HY-14450
    JNJ-31020028 Antagonist
    JNJ-31020028 is a selective brain penetrant antagonist of neuropeptide Y2 receptor with high affinity(pIC50=8.07, human; pIC50=8.22 rat); >100-fold selective versus human Y1/Y4/Y5 receptors.
  • HY-P1537
    Pancreatic Polypeptide, bovine Agonist
    Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4. Sequence: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2;APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY-NH2.
  • HY-P1127
    Galanin (1-30), human Agonist
    Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS.
  • HY-P1601
    Neuropeptide Y(29-64)
    Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Sequence: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY.
  • HY-P1532
    Pancreatic Polypeptide, rat Agonist
    Pancreatic Polypeptide, rat is an agonist of NPY receptor, with high affinity at NPYR4. Sequence: Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2;APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2.
  • HY-P1480
    Neuropeptide Y (13-36), amide, human Agonist
    Neuropeptide Y (13-36), amide, human is a neuropeptide Y receptor agonist. Sequence: Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2;PAEDMARYYSALRHYINLITRQRY-NH2.
  • HY-P0198
    Neuropeptide Y (29-64), amide, human
    Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide. Sequence: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2.
  • HY-P1514
    Peptide YY (PYY), human
    Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors. Sequence: Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.
  • HY-P0199
    Pancreatic Polypeptide, human Agonist
    Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Sequence: Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2.
  • HY-107382
    RF9 Antagonist 98.24%
    RF9 is a potent and selective Neuropeptide FF receptor antagonist, with Kis of 58±5 and 75±9 nM for hNPFF1R and hNPFF2R, respectively.
  • HY-P1025
    M40 Antagonist 98.25%
    M40 is a potent, non-selective galanin receptor antagonist. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Ala-Leu-Ala-Leu-Ala-NH2;GWTLNSAGYLLGPPPALALA-NH2.
  • HY-P0262
    Galantide Antagonist
    Galantide is a reversible and non-specific galanin receptor antagonist. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2;GWTLNSAGYLLGPQQFFGLM-NH2.