2. GPCR/G Protein
  3. GCGR

GCGR

GCGR (glucagon receptor) is in the G protein-coupled receptor family, that is important in controlling blood glucose levels. The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to G alpha i, Gs and to a lesser extent G alpha q. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney with lesser amounts found in heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

GCGR Related Products (118):

Cat. No. Product Name Effect Purity
  • HY-13443
    Exendin-4 Agonist 99.85%
    Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
  • HY-114118
    Semaglutide Agonist
    Semaglutide, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide has the potential for type 2 diabetes treatment.
  • HY-P1731B
    Tirzepatide hydrochloride Agonist 99.82%
    Tirzepatide hydrochloride (LY3298176 hydrochloride) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes[1].
  • HY-10930
    UNC0321 Inhibitor
    UNC0321 is a potent and selective histone methyltransferase G9a inhibitor with a Ki of 63 pM and with assay-dependent IC50 values of 6-9 nM. UNC0321 also inhibits GLP with assay-dependent IC50 values of 15-23 nM. UNC0321 has anti-apoptotic activity and has potential application in diabetic vascular complications[1][3].
  • HY-P0014
    Liraglutide Agonist 99.68%
    Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus.
  • HY-116819A
    VU0453379 hydrochloride Modulator
    VU0453379 hydrochloride is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM[1].
  • HY-P5161A
    FC382K10W15 TFA Agonist
    FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research[1].
  • HY-153476
    GIP/GLP-1 dual receptor agonist-1 Agonist
    GIP/GLP-1 dual receptor agonist-1 (compound 4) is a GIP/GLP-1 receptor agonist. GIP/GLP-1 dual receptor agonist-1 can be used in the research of metabolic disorders and fatty liver diseases, including nonalcoholic steatohepatitis (NASH) and nonalcoholic fatty liver disease (NAFLD)[1].
  • HY-121835
    GLP-1R agonist 2 Agonist
    GLP-1R agonist 2 (compound 2) is a potent GLP-1R agonist. GLP-1R agonist 2 has the potential for the research of metabolic diseases like Type2 Diabetes and Obesity[1].
  • HY-P3102
    GLP-1(32-36)amide 98.43%
    GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice[1][2].
  • HY-P2497
    Exendin (5-39) Antagonist 99.81%
    Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats[1].
  • HY-P1145
    Glucagon-like peptide 1 (1-37), human Agonist
    Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-141840
    GLP-1R modulator C5 Modulator 99.60%
    GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 μM).
  • HY-P1141A
    GLP-1(9-36)amide TFA Antagonist
    GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor[1][2].
  • HY-P0119A
    Lixisenatide acetate Agonist 99.65%
    Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
  • HY-P1226
    HAEGTFTSD Agonist 98.04%
    HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner[1]
  • HY-P0212A
    Neuropeptide Y, porcine TFA
    Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion[1].
  • HY-144135
    GLP-1R agonist 7 Agonist
    GLP-1R agonist 7 is a potent GLP-1R agonist with an EC50 of 0.67 µM (WO2021244645A1, compound WXA001)[1].
  • HY-P3506
    Retatrutide Antagonist 99.31%
    Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide inhibits for human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide can be used for the research of obesity[1].